-
Gut microbiota influence bladder tumour development Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-09-16 Louise Lloyd
New research, published in Nature, shows that gut microbiota carcinogen metabolism could contribute to chemical-induced carcinogenesis in the bladder. Chronic exposure to N-butyl-N-(4-hydroxybutyl)-nitrosamine (BBN) induces bladder cancer in mouse models. Thus, the investigators used this model to examine the influence of gut microbiota on BBN-induced carcinogenesis and toxicokinetics.
-
Prescribing clinician specialty influences adherence to PrEP Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-09-13 Maria Chiara Masone
In a new study published in JAMA Internal Medicine, the association between patients abandoning or reversing the pre-exposure prophylaxis (PrEP) prescription and the specialty of the prescribing clinician has been assessed. Overall, 37,003 patients who were prescribed PrEP were assessed using pharmacy claims data. The majority of patients (67%) received their prescription from primary care practitioners
-
Intralesional heterogeneity on PSMA PET–CT predicts mCRPC outcomes Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-09-13 Maria Chiara Masone
Intra-tumour heterogeneity in patients with metastatic castration-resistant prostate cancer (mCRPC) poses a challenge to treatment, owing to variability in tumour growth and response to therapy. Currently available tools such as response evaluation criteria in solid tumors (RECIST) and circulating tumour DNA (ctDNA) are useful methods to measure patient response to treatment but do not enable the assessment
-
piRNA pathway disruption in human infertility Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-09-13 Maria Chiara Masone
PIWI-interacting RNAs (piRNAs) are crucial regulators of gene expression in male germ cells. In a study published in Nature Communications, the effect of disrupting piRNA biogenesis on human spermatogenesis was assessed. Analysis of exome data from >2,000 men with infertility led to the identification of biallelic variants in 14 genes related to the piRNA pathway in these men. These variants were associated
-
A wearable UBVM device to monitor bladder volume Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-09-13 Maria Chiara Masone
Measuring bladder volume is essential to assess bladder function for diagnosis and monitoring of lower urinary tract dysfunction, but currently available methods such as catheterization or ultrasonography are invasive and limited to the hospital setting. In a new study published in Nature Communications, a wireless and flexible ultrasonic bladder volume monitoring (UBVM) device was developed for continuous
-
AI in prostate MRI: enhancing accuracy and reducing overdiagnosis Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-09-11 Baris Turkbey
Artificial intelligence can be leveraged to improve the detection of prostate cancer on magnetic resonance imaging; however, before this technology is implemented in clinical practice, further research is required.
-
Human sperm RNA in male infertility Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-09-10 Rossella Cannarella, Andrea Crafa, Roberto Curto, Laura M. Mongioì, Vincenzo Garofalo, Vittorio Cannarella, Rosita A. Condorelli, Sandro La Vignera, Aldo E. Calogero
-
PIONEER big data platform for prostate cancer: lessons for advancing future real-world evidence research Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-09-09 Ailbhe Lawlor, Katharina Beyer, Beth Russell, Carl Steinbeisser, Anders Bjartell, Bertrand De Meulder, Muhammad Imran Omar, Tim Hulsen, John Butler, James N’Dow, Juan Gómez Rivas, Giorgio Gandaglia, Rossella Nicoletti, Vasileios Sakalis, Emma Jane Smith, Monika Maass, Jihong Zong, Louise Fullwood, Thomas Abbott, Azadeh Tafreshiha, Kishore Papineni, Robert Snijder, Denis Horgan, Sarah Seager, Susan
-
Non-coding transcriptome profiles in clear-cell renal cell carcinoma Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-09-06 Tereza Tesarova, Ondrej Fiala, Milan Hora, Radka Vaclavikova
-
Artificial intelligence in the management of prostate cancer Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-09-04 Raghav Khanna, Alejandro Granados Martinez, Nicholas Raison, Sebastien Ourselin, Alberto Briganti, Francesco Montorsi, Prokar Dasgupta
Artificial intelligence (AI) is transforming prostate cancer management from diagnosis to treatment. AI tools have been designed for the analysis of digitized histopathology and MRI scans, generation of synthetic CT scans and improvement of robotic surgical outcomes. This progress underscores the need for regulation and the development of safe, ethical and non-biased software.
-
Videourodynamics — role, benefits and optimal practice Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-08-29 Mikolaj Przydacz, Howard B. Goldman
-
The interplay between male fertility, mental health and sexual function Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-08-27 Vincent J. Straub, Melinda C. Mills
-
Quest for a genetic biomarker for sickle cell disease priapism: rationale, progress and implications Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-08-27 Oluwafolajimi Adesanya, Arthur L. Burnett
Currently, no consensus biomarker exists for predicting priapism associated with sickle cell disease. Biochemical and haematological parameters have been investigated, but they are limited by a lack of specificity and the need for pre-validated thresholds. Genetic biomarkers are a potential alternative for further consideration in future efforts.
-
Immune effects of α and β radionuclides in metastatic prostate cancer Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-08-27 Sapna Lunj, Tim Andrew Davies Smith, Kimberley Jayne Reeves, Fred Currell, Jamie Honeychurch, Peter Hoskin, Ananya Choudhury
-
Field effect and forerunner genes drive bladder cancer initiation Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-08-12 Maria Chiara Masone
The idea that common epithelial cancers evolve from dysplasia or carcinoma in situ has been challenged by the discovery of occult disease in normal-appearing cells, known as the field effect, which interests areas that might form large plaques in the mucosal membrane. Forerunner (FR) genes, which map to genomic regions close to established tumour-suppressor genes, seem to have a role in this process
-
Utility of PSA screening in transgender women receiving oestrogens Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-08-09 Maria Chiara Masone
Transgender women are more likely to be diagnosed with high-grade prostate cancer than cisgender men, which might be ascribed to a delayed diagnosis. In a study published in JAMA, the authors assessed prostate-specific antigen (PSA) values in a cohort of transgender women receiving oestrogen treatment, prompted by the rationale that the levels of PSA (which are regulated by androgen) might be altered
-
Single-cell analysis of advanced prostate cancer Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-08-09 Louise Lloyd
Single-cell analysis of treatment-resistant prostate cancer demonstrated high heterogeneity between cell states across various advanced disease types, including castration-resistant and neuroendocrine prostate cancers. Expression of PSMA, STEAP1, STEAP2, TROP2, CEACAM5 and DLL3 were observed to vary within a subset of gene regulatory networks. Thus, gene regulatory networks could be used to identify
-
AI for drug discovery Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-08-09 Louise Lloyd
Virtual screening using Rosetta software and an online server was employed to design a proteolysis-targeting chimera drug targeting p300 for prostate cancer therapy. Rosetta calculated the overall interface binding score and fold stability score. The amino acid with the highest frequency at each interface site was selected for generating the final peptide sequence, which was CPWIWDGDNKDDNSTDGGGSGGGTSFEQFWAWLWP
-
Urology’s carbon footprint Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-08-09 Louise Lloyd
A cradle-to-grave life-cycle assessment has been undertaken of the greenhouse gas emissions from the transurethral resection of bladder tumour (TURBT) pathway. The median carbon footprint of perioperative TURBT was 131.8 kg of CO2 equivalent. Multiple modifiable hotspots were found, including minimizing avoidable patient travel, rationalizing equipment use, optimally filling operating theatre lists
-
Immunotherapy for penile cancer Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-08-09 Louise Lloyd
Single-agent retifanlimab has shown promising signs of clinical activity in advanced and metastatic penile squamous cell carcinoma with no new safety signals. Objective response rate was 16.7% and three patients had a partial response. Median progression-free survival was 2.0 months and median overall survival was 7.2 months. One patient experienced a grade 3 treatment-related adverse event. The results
-
Accurate information provided by artificial intelligence Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-08-08 Louise Lloyd
Accurate information concerning urological issues can be obtained from artificial intelligence chatbots, according to the results of two recent studies. However, understandability and actionability could be improved. ChatGPT4.0 showed utility in aiding clinical decision-making regarding male infertility. The performance of ChatGPT4.0 in answering 1,073 true or false, multiple-choice and open-ended
-
Neoadjuvant lutetium PSMA, the TIME and immune response in high-risk localized prostate cancer Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-08-07 Renu S. Eapen, Scott G. Williams, Sean Macdonald, Simon P. Keam, Nathan Lawrentschuk, Lewis Au, Michael S. Hofman, Declan G. Murphy, Paul J. Neeson
-
Molecular biomarkers of progression in non-muscle-invasive bladder cancer — beyond conventional risk stratification Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-08-02 Mitchell Olislagers, Florus C. de Jong, Vera C. Rutten, Joost L. Boormans, Tokameh Mahmoudi, Tahlita C. M. Zuiverloon
-
From foes to friends: rethinking the role of lymph nodes in prostate cancer Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-08-02 Raghav Gupta, Chandan K. Das, Sujit S. Nair, Adriana Marcela Pedraza-Bermeo, Ali H. Zahalka, Natasha Kyprianou, Nina Bhardwaj, Ashutosh K. Tewari
-
Paternal microbiome perturbations affect offspring outcomes Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-07-26 Jamie O. Lo, Charles A. Easley
-
Syphilis on the rise — a need for alternative therapies and vaccines Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-07-16 Maria Chiara Masone
Syphilis, caused by the bacterium Treponema pallidum subsp. pallidum (TPA), re-emerged as a global health problem in the twenty-first century, with a drastic increase in syphilis diagnoses reported in the past 20 years. Injection with the long-acting benzathine penicillin G is the gold-standard treatment for syphilis, but the increased number of patients combined with a limited supply chain capacity
-
Krause corpuscles act as genital vibration detectors Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-07-16 Annette Fenner
First described in the 1850s by Wilhelm Krause, the function and physiological functions of the sensory structures that bear his name have remained unclear. However, a study in Nature has shown that Krause corpuscles have an important role in genital sensation. The team from Harvard University began by assessing the distribution and density of Krause corpuscles. In the genitalia of female mice, corpuscles
-
Increased xenokidney survival Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-07-15 Louise Lloyd
Survival of xenograft kidneys in allosensitized recipients is extended when using kidneys from pigs with multiple genetic changes. This observation suggests that highly allosensitized patients could obtain great benefit from clinical implementation of xenotransplantation. In this preclinical, non-human primate study, rhesus macaques were first highly allosensitized. Next, five of these macaques received
-
Alternative promoters activate oncogenic programmes Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-07-12 Louise Lloyd
Use of alternative promoters by oncogene transcription factors increases as prostate tumours progress from benign to metastatic castration-resistant disease. This observation indicates that alternative promoter use intensifies the transcriptional effects of tumour-driving genes in prostate cancer. Deep RNA-sequencing analysis of 274 biopsy samples of benign prostate tissue, localized prostate tumours
-
Microplastics in the penis Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-07-12 Louise Lloyd
The presence of microplastics has been found in human penile tissue. This discovery has implications for male fertility and our understanding of the effects of environmental pollutants on reproductive health. This study involved six participants who were undergoing surgery for a multi-component inflatable penile prosthesis. A stringent protocol for sample collection from the corpora was implemented
-
Optimizing cystoscopy and TURBT: enhanced imaging and artificial intelligence Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-07-09 Eugene Shkolyar, Steve R. Zhou, Camella J. Carlson, Shuang Chang, Mark A. Laurie, Lei Xing, Audrey K. Bowden, Joseph C. Liao
-
Biological determinants of PSMA expression, regulation and heterogeneity in prostate cancer Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-07-08 Martin K. Bakht, Himisha Beltran
-
Author Correction: Advances in sliding clip renorrhaphy for partial nephrectomy. Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-07-05 David Homewood,Tayla Fay,Nicholas Tan,Andrew Silagy,Niall M Corcoran,Nathan Lawrentschuk,Dinesh Agarwal
-
CRISPR–Cas9 potential for identifying novel therapeutic targets in muscle-invasive bladder cancer Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-07-01 Danielle J. Smith, Sapna Lunj, Antony D. Adamson, Sankari Nagarajan, Tim A. D. Smith, Kimberley J. Reeves, Peter J. Hoskin, Ananya Choudhury
-
De-clear cell differentiated renal cell carcinoma — a new therapeutic target Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-06-27 Keith A. Lawson, W. Marston Linehan
-
Advances in sliding clip renorrhaphy for partial nephrectomy Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-06-25 David Homewood, Tayla Fay, Nicholas Tan, Andrew Silagy, Niall M. Corcoran, Nathan Lawrentschuk, Dinesh Argarwal
Partial nephrectomy aims to provide both effective oncological management and renal function preservation. Surgical complications pertaining to the defect created during a partial nephrectomy include haemorrhage and urinary leak. We explore advances in techniques for managing the defect created during a partial nephrectomy (renorrhaphy).
-
Renal mass biopsy — a practical and clinicopathologically relevant approach to diagnosis Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-06-21 Hussein Mansour, My-Anh Tran-Dang, Miles Walkden, Ekaterini Boleti, Ravi Barod, Prasad Patki, Faiz Mumtaz, Maxine G. B. Tran, Axel Bex, Soha El Sheikh
-
The bladder tumour microbiome and BCG response Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-06-18 Louise Lloyd
BCG treatment is the gold-standard therapy for high-grade intermediate-risk and high-risk non-muscle-invasive bladder cancer (NMIBC). However, ~30−40% of patients who receive BCG experience treatment failure, and the mechanisms by which it acts are not well understood. Thus, the role of the tumour microbiome in bladder cancer treatment response has gained increasing interest. Now, new data have provided
-
Progression-free survival end points in prostate cancer: are we truly making progress Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-06-17 Ravi A. Madan, Edwin M. Posadas, Richard J. Lee
Recently, several therapeutic strategies in prostate cancer have been granted regulatory approval based on progression-free survival benefits alone, which is a relative change in the therapeutic development of prostate cancer treatments. Previously, overall survival was a requirement for approvals. Whether this approach is warranted or beneficial to patients remains unclear.
-
Single-cell penile cancer atlas to identify disease drivers Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-06-14 Maria Chiara Masone
Penile squamous cell carcinoma (PSCC) can be classified into human papilloma virus-positive (HPV+) and HPV-independent (HPV–). HPV+ tumours have higher rates of poorly differentiated disease than HPV– tumours. However, a lower cancer-specific mortality (CSM) has been reported in patients with HPV+ versus HPV– disease. This evidence might be partially explained by a disproportionate occurrence of loss-of-function
-
Promising efficacy of UTI vaccines as an alternative to antibiotics Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-06-14 Quentin Mak, Julian Greig, Prokar Dasgupta, Sachin Malde, Nicholas Raison
Antibiotics are the mainstay prophylaxis and treatment for recurrent urinary tract infections (UTIs). However, antibiotic resistance is rising globally, leading to infections that are harder to treat. In view of this resistance, alternative, non-antibiotic treatments for recurrent UTIs are now being developed; among them, UTI vaccines have shown promising results.
-
A prompt-based stewardship to reduce extended-spectrum antibiotic treatment in UTI Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-06-13 Maria Chiara Masone
Hospitalized patients with urinary tract infection (UTI) often receive treatment with extended-spectrum antibiotics while waiting for culture results, as a precaution in case of multidrug-resistant organism (MDRO) infections. However, most of these patients could be treated with standard-spectrum antibiotics. In the cluster-randomized INSPIRE trial, the effect of the new INSPIRE antibiotic stewardship
-
A new signalling-based system for germ cell reprogramming Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-06-13 Maria Chiara Masone
Differentiation of human primordial germ cells (hPGCs) to mitotic spermatogonia and oogonia occurring through epigenetic reprogramming is a fundamental process of development. hPGC-like cells (hPGCLCs) have been successfully induced in vitro starting from human pluripotent stem cells (hPSCs) but have low efficiency and are prone to de-differentiation. In a paper published in Nature, the authors established
-
Engaging medical students in urological academic research Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-06-11 Kamil Malshy, Taylor Braunagel, Anna Ochsner, Borivoj Golijanin, Elias Hyams
-
Rediscovering citrate as a biomarker for prostate cancer Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-29 Lucas Galey, Ayokunle Olanrewaju, Hermann Nabi, Jean-Sébastien Paquette, Frédéric Pouliot, Étienne Audet-Walsh
-
Nocturia and obstructive sleep apnoea Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-23 Olaf P. J. Vrooman, Philip E. V. van Kerrebroeck, Michael R. van Balken, Gommert A. van Koeveringe, Mohammad S. Rahnama’i
-
Preclinical models of bladder cancer: BBN and beyond Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-20 David Matye, Juliann Leak, Benjamin L. Woolbright, John A. Taylor
-
Overall survival with adjuvant pembrolizumab in renal cell carcinoma — the shock of the lightning Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-17 Francesco Massari, Matteo Rosellini, Veronica Mollica
-
Promoting the health of men of all backgrounds: educating ourselves to build trust and improve care Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-16 Danly Omil-Lima, Austin Thompson, Kyle Scarberry, Benjamin Crawshaw
Specific issues affect the treatment of urological cancer and survivorship in gay and bisexual men. Creating an accepting and inclusive environment for these patients in our men’s health clinics can help to improve the quality of life for men from sexual minority groups undergoing cancer treatment.
-
AUA24 — pioneering shared decision-making and patient engagement strategies Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-15 Maria Chiara Masone
Urologists, scientists and other professionals in the urology field converged in San Antonio, Texas, to attend the 119th edition of the American Urological Association (AUA) Annual Meeting. An intense and variegated programme was put together to cover the latest advances in different areas of urology, with an eye to the future of the field. Providing an equitable health care for Black men, who experience
-
Chromosome segregation in SCNT oocytes Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-14 Louise Lloyd
The possibility of men in same-sex relationships and people who do not have their own eggs having biological children has been advanced by new research into in vitro gametogenesis, in which functional haploid gametes are generated from diploid somatic cells. In previous, proof-of-principle experiments showing that haploidy in somatic cell genomes can be induced experimentally by premature cell division
-
Overcoming barriers in cancer care for gender minorities Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-13 David J. Benjamin, Omid Yazdanpanah, Arash Rezazadeh Kalebasty
As the population of gender minorities grows in the setting of rising incidence of cancers globally, health-care professionals and institutions must be prepared to provide inclusive care. Individual-level training as well as institutional-level efforts on gender identity data collection and creation of inclusive clinical spaces could help mitigate health-care disparities.
-
We all get erections — de-gendering sexual arousal dysfunction in the ICD Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-08 Lucy Greenwald, Daniel R. Dickstein, Barbara Chubak, Deborah C. Marshall
-
Breaking the silence: normalizing receptive anal intercourse for patients, for people and for myself Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-08 Daniel R. Dickstein
The lack of information and discussion on receptive anal intercourse (RAI) perpetuates the stigma. Normalizing RAI and empowering individuals to embrace their sexuality without shame or judgement requires us to confront biases, foster dialogue and break the silence.
-
Centralization of care for rare genetic syndromes associated with cancer: improving outcomes and advancing research on VHL disease Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-08 Alessandro Larcher, Federico Belladelli, Francesco Cei, Chiara Re, Isaline Rowe, Francesco Montorsi, Umberto Capitanio, Andrea Salonia
-
Asexuality: the invisible orientation Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-07 Sarah Cosgriff, Stella Schneckenburger
Asexuality is often neglected in education and conversations around sexuality, making it essentially an ‘invisible orientation’. This lack of knowledge is associated with harmful misconceptions, which need challenging within the medical profession and in the general population to ensure inclusion of people who identify on the asexual spectrum.
-
Elevated periprostatic androgens, sneaky testosterone and its implications Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-07 Masoud Bitaraf, Ranjith Ramasamy, Sanoj Punnen, Nima Sharifi
-
Current and emerging strategies to curb antibiotic-resistant urinary tract infections Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-07 Aaron Simoni, Laura Schwartz, Guillermo Yepes Junquera, Christina B. Ching, John David Spencer
-
The evolving treatment landscape of metastatic urothelial cancer Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-03 Giandomenico Roviello, Matteo Santoni, Guru P. Sonpavde, Martina Catalano
-
Von Hippel–Lindau protein signalling in clear cell renal cell carcinoma Nat. Rev. Urol. (IF 12.1) Pub Date : 2024-05-02 Chengheng Liao, Lianxin Hu, Qing Zhang