Impaired oxygen-sensitive regulation of mitochondrial biogenesis within the von Hippel–Lindau syndrome

Li, Shuijie; Li, Wenyu; Yuan, Juan; Bullova, Petra; Wu, Jieyu; Zhang, Xuepei; Liu, Yong; Plescher, Monika; Rodriguez, Javier; Bedoya-Reina, Oscar C.; Jannig, Paulo R.; Valente-Silva, Paula; Yu, Meng; Henriksson, Marie Arsenian; Zubarev, Roman A.; Smed-Sörensen, Anna; Suzuki, Carolyn K.; Ruas, Jorge L.; Holmberg, Johan; Larsson, Catharina; Christofer Juhlin, C.; von Kriegsheim, Alex; Cao, Yihai; Schlisio, Susanne

doi:10.1038/s42255-022-00593-x

Download PDF

Article
Open access
Published: 27 June 2022

Impaired oxygen-sensitive regulation of mitochondrial biogenesis within the von Hippel–Lindau syndrome

Nature Metabolism volume 4, pages 739–758 (2022)Cite this article

11k Accesses
7 Citations
156 Altmetric
Metrics details

Subjects

A Publisher Correction to this article was published on 08 September 2022

This article has been updated

Abstract

Mitochondria are the main consumers of oxygen within the cell. How mitochondria sense oxygen levels remains unknown. Here we show an oxygen-sensitive regulation of TFAM, an activator of mitochondrial transcription and replication, whose alteration is linked to tumours arising in the von Hippel–Lindau syndrome. TFAM is hydroxylated by EGLN3 and subsequently bound by the von Hippel–Lindau tumour-suppressor protein, which stabilizes TFAM by preventing mitochondrial proteolysis. Cells lacking wild-type VHL or in which EGLN3 is inactivated have reduced mitochondrial mass. Tumorigenic VHL variants leading to different clinical manifestations fail to bind hydroxylated TFAM. In contrast, cells harbouring the Chuvash polycythaemia VHL^R200W mutation, involved in hypoxia-sensing disorders without tumour development, are capable of binding hydroxylated TFAM. Accordingly, VHL-related tumours, such as pheochromocytoma and renal cell carcinoma cells, display low mitochondrial content, suggesting that impaired mitochondrial biogenesis is linked to VHL tumorigenesis. Finally, inhibiting proteolysis by targeting LONP1 increases mitochondrial content in VHL-deficient cells and sensitizes therapy-resistant tumours to sorafenib treatment. Our results offer pharmacological avenues to sensitize therapy-resistant VHL tumours by focusing on the mitochondria.

A CRISPRi/a screening platform to study cellular nutrient transport in diverse microenvironments

Article Open access 11 April 2024

Mitochondrial H2O2 release does not directly cause damage to chromosomal DNA

Article Open access 28 March 2024

Ferroptosis: molecular mechanisms and health implications

Article Open access 02 December 2020

Main

Hypoxia-inducible transcription factor-α (HIFα) functions as a key regulator of cellular and systemic homeostatic responses to hypoxia. The process orchestrating the oxygen-sensitive regulation of the HIFs is regulated by the oxygen-dependent activity of the prolyl hydroxylase enzymes (EGLN). Prolyl hydroxylation of HIFα allows substrate recognition by the von Hippel–Lindau tumour-suppressor protein (pVHL) causing HIFα ubiquitination and degradation under normal oxygen concentrations^1,2,3. Although mitochondria are the major consumers of oxygen in the cell, mitochondrial biogenesis has not been reported to be directly regulated by HIFα. However, HIF1α has been reported to potentially inhibit mitochondrial biogenesis indirectly by repression of c-MYC activity⁴.

Von Hippel–Lindau (VHL) disease is a hereditary cancer syndrome caused by mutations of the VHL gene resulting in different tumour subtypes including haemangioblastoma (HB) of the retina and the nervous system, clear cell renal cell carcinoma (ccRCC) and pheochromocytoma and paraganglioma (PPGL)⁵. HIF2α deregulation plays an important role in VHL-defective tumours; however, HIF2α mutations have only been observed in some sporadic cases of PPGL and have not been observed in ccRCC^6,7,8. Moreover, the discovery of the oxygen-sensitive regulation of HIFα by pVHL cannot explain the mechanisms underlying the complex genotype–phenotype correlations in VHL syndrome. Type 1 VHL disease is defined as ccRCC and HB with low risk of PPGL and caused by truncating or missense VHL mutations. In contrast, type 2 VHL disease is associated with VHL-missense mutations and defined by PPGL, either alone (type 2C) or in combination with HB (type 2A) or with HB and ccRCCs (type 2B). Importantly, some germline type 2C VHL mutants in familial PPGL retain the ability to suppress HIFα^9,10. Therefore, VHL’s canonical substrate, HIFα, cannot fully explain the complex genotype–phenotype manifestation within the VHL syndrome and there is no evidence that HIFα deregulation is sufficient to cause cancer¹¹. Instead, a number of other VHL functions independent of HIFα regulation have been ascribed to pVHL, including binding to fibronectin, collagen, atypical PKC, SFMBT1, TBK1, ZHX2 and AKT^{12,13,14,15,16,17,18,19}. Previously, we also described a new VHL target, BIM-EL, that links type 2C VHL mutations to PPGL independent of HIFα regulation²⁰.

Another puzzling phenotype of VHL germline mutations has been described in individuals from the Chuvash region who are homozygotes for the VHL^R200W mutation²¹. Whereas germline VHL mutations commonly predispose individuals to the development of multiple tumours, homozygous carriers of germline VHL^R200W mutations show total absence of tumour development despite increased HIFα signalling^22,23,24. These individuals present with a congenital erythrocytosis (excess of red blood cell production) named Chuvash polycythaemia²¹. The absence of tumour development in people with Chuvash polycythaemia suggests that deregulation of HIFα may not be sufficient to drive tumorigenesis in the VHL cancer syndrome and that VHL has other substrates that are required for tumour suppression.

Here we identified an oxygen-sensitive function of pVHL regulating mitochondrial biogenesis independent of the canonical substrate HIFα, that is defective in all VHL cancer syndrome mutations we tested, but normal in the VHL^R200W Chuvash mutation. Mitochondrial transcription factor A (TFAM), a key activator of mitochondrial transcription and replication, is hydroxylated by the oxygen-sensitive hydroxylase EGLN3 on proline 53/66 and subsequently bound and stabilized by pVHL. VHL-related tumours such as PPGL and ccRCC show low mitochondrial content, implicating that lack of mitochondrial content is related to malignancies of tumorigenesis in the VHL syndrome.

Results

Mitochondrial content is regulated by pVHL

Germline type 2C VHL mutations predisposing to PPGL retain the ability to suppress HIFα^9,10. To identify the pVHL functions independent of its canonical substrate HIFα, we performed comparative proteomics of PPGL (n = 10) with wild-type or mutated VHL (Extended Data Fig. 1a). The cellular proteomes from primary PPGL tumours were extracted and analysed by nanoscale liquid chromatography coupled to tandem mass spectrometry (nanoLC–MS/MS). A total of 6,196 proteins were identified and quantified, 5,576 of which were common to all the samples (Supplementary Table 1). To investigate the effect of VHL mutations, we combined the proteomes of all the VHL wild-type PPGL samples and compared it with the VHL-mutant proteome (Fig. 1a). We observed a significantly larger percentage of mitochondrial proteins downregulated in VHL-mutant samples as compared to wild-type PPGL samples (Fig. 1a,b and Extended Data Fig. 1b; uncorrected P value = 7.95 × 10⁻³⁵, Fisher exact test). Among the significantly differentially expressed proteins, 36 of the top 50 (that is, 72%) that were downregulated in VHL-mutant PPGL samples were mitochondrial proteins including the mitochondrial-encoded protein MT-CO3 (Fig. 1c), implicating that mitochondrial proteomes differ between VHL-mutant and wild-type PPGL. Furthermore, Gene Ontology (GO) term enrichment was tested among the top 50 significantly upregulated and downregulated proteins (Fig. 1d; P < 0.05, two-tailed unpaired t-test). Response to hypoxia and pyruvate metabolism were found as the most significantly enriched biological processes for the upregulated proteins, while downregulated proteins related to electron transport and mitochondrial content were overrepresented in biological processes and cellular components according to false discovery rate values in STRING results (Fig. 1d and Extended Data Fig. 1c).

**Fig. 1: pVHL regulates of mitochondrial mass independent of HIFα.**

HIFα activation has been reported to be sufficient for many of the manifestations of VHL loss^1,2,3 and HIFα activation has also been reported to inhibit mitochondrial biogenesis⁴. To understand if the downregulation of mitochondrial proteins in VHL-mutant PPGL is dependent on HIFα, we tested type 2C VHL mutants that predispose to PPGL without grossly deregulating HIFα⁹. Compared to wild-type VHL, the type 2C VHL mutants (VHL^L188V and VHL^R64P) were clearly defective with respect to restoring abundance of mitochondrial proteins despite their ability to repress HIF2α (Fig. 1e). In particular, PGC1α, a key transcriptional co-activator regulating mitochondrial biogenesis²⁵ was unaffected. To exclude potential effects of HIF2α regulating TFAM expression, we depleted EPAS1 (HIF2α) in 786-O cells (Extended Data Fig. 1e). EPAS1 loss in cells expressing wild-type pVHL (VHL-WT) or VHL-null cells had no effect on TFAM protein expression. Similarly to 786-O cells, wild-type VHL restored abundance of mitochondrial proteins in another ccRCC cell line, A498 (Extended Data Fig. 1d).

In addition, mitochondrial stainings of 786-O cells using MitoTracker combined with flow cytometry analysis confirmed that mitochondrial fluorescence intensity is restored in VHL wild-type cells, but not in type 2C VHL-mutant cells (Fig. 1f). Analysing the proteome of VHL-null and VHL^L188V cells confirmed that the percentage of mitochondrial proteins was significantly lower in both VHL-null cells (uncorrected P value = 4.51 × 10⁻⁴⁴, Fisher exact test) as well as in type 2 VHL-mutant cells (uncorrected P value = 2.94 × 10⁻²¹, Fisher exact test) as compared to VHL wild-type-expressing cells (Fig. 1g,h, Extended Data Fig. 1h,i and Supplementary Table 2) Importantly, the majority of significant downregulated mitochondrial proteins in VHL-null cells (total of 656) was shared with the mitochondrial proteome in type 2C VHL^L188V cells (407 shared mitochondrial proteins; Extended Data Fig. 1f), suggesting a HIFα-independent function of pVHL. Indeed, the percentage of significantly downregulated mitochondrial proteins that was shared between VHL^L188V and VHL-null cells was significantly higher than for significantly downregulated non-mitochondrial proteins (odds ratio = 1.26, uncorrected P value = 0.0098, Fisher exact test). Additionally, the percentage of downregulated mitochondrial proteins shared between VHL mutated PPGL and VHL^L188V cells (Extended Data Fig. 1g) was also significantly higher than for significantly downregulated non-mitochondrial proteins (odds ratio = 3.27, uncorrected P value = 4.64 × 10⁻⁵, Fisher exact test), indicating HIFα-independent function of pVHL.

Furthermore, it has been previously reported that primary ccRCC cells display minimal mitochondrial respiratory capacity and low mitochondrial number²⁶. Thus, we asked if other VHL type 1 (low risk PPGL), type 2A (low risk ccRCC) or type 2B (high risk ccRCC) mutants present similarly low mitochondrial contents as those observed in the type 2C VHL mutants. Only the reintroduction of wild-type VHL but none of the type 1, 2A, 2B or 2C mutations tested could restore the expression of mitochondrial proteins (Fig. 1i). In addition, we confirmed low mitochondrial content in a genetically defined system, using Cre-mediated deletion of VHL in mouse embryonic fibroblasts (MEFs) homozygous for a floxed VHL allele (Fig. 1j,k).

Regulation of mitochondrial mass is hydroxylation dependent

pVHL has previously been shown to bind hydroxylated prolines of other substrates besides HIFα, such as AKT, BIM-EL, ZHX2 and pTBK1 (refs. ^16,19,20,27). To determine if regulation of mitochondrial content by pVHL is mediated by proline hydroxylation, we cultured 786-O cells expressing exogenous HA-VHL under anoxia (0.1% oxygen) or with hydoxylase inhibitor dimethyloxalylglycine (DMOG) and found that mitochondrial protein levels were decreased, similar to those of VHL-null cells under these conditions (Fig. 2a). To investigate the prolyl hydroxylase that may contribute to the regulation of mitochondrial proteins by pVHL, we silenced the three EGLN family members in HeLa and 786-O cells expressing VHL and found that EGLN3 is the primary prolyl hydroxylase that showed the most robust decrease of mitochondrial proteins (Fig. 2b and Extended Data Fig. 2a,b). Consistent with these results, MitoTracker stainings of mitochondria and corresponding flow cytometry analysis confirmed significantly low mitochondrial content in VHL-expressing cells in which EGLN3 was downregulated with shRNA (Fig. 2c,d). To understand the impact of mitochondrial content by loss of EGLN3 in vivo, we analysed tissues from EGLN3^−/− knockout (KO) mice. Mitochondrial proteins in EGLN3^−/− mouse superior cervical ganglia (P1 SCG), adult adrenal medulla and cerebellum (P7) were remarkably reduced (Fig. 2e and Extended Data Fig. 2c). However, other tissues such as heart and skeletal muscle did not show any changes in mitochondrial protein content (Fig. 2f and Extended Data Fig. 2d). It is possible that degradation of mitochondrial proteins by mitochondrial protease LONP1 might contribute to these tissue-specific differences. Low LONP1 protein expression in skeletal muscle and heart is demonstrated in the Human Protein Atlas (https://www.proteinatlas.org/ENSG00000196365-LONP1/tissue/) and thus might contribute to higher mitochondrial content in these tissues independent of EGLN3 expression.

**Fig. 2: pVHL regulation of mitochondrial mass is hydroxylation and EGLN3 dependent.**

In addition, we detected decreased expression of mitochondrial proteins in EGLN3^−/− MEFs when cultured more than five passages (p5), but not in their first or second passage (Extended Data Fig. 2e,f). MitoTracker staining visualizing mitochondria and corresponding flow cytometry analysis confirmed significant low mitochondrial content in EGLN3^−/− MEFs cultured beyond five passages (Extended Data Fig. 2g). Consistent with our observations in 786-O cells expressing wild-type pVHL (Fig. 2a), EGLN3 wild-type MEFs (p5) showed low abundance of mitochondrial proteins when cultured under anoxia, or with hydroxylase inhibitors (Extended Data Fig. 2h). To confirm that low mitochondrial content in EGLN3^−/− MEFs (p5) is mediated by EGLN3 hydroxylase activity, we transduced cells with lentivirus encoding WT EGLN3 or a catalytically dead p.His196Arg EGLN3 mutant. Mitochondrial content was restored in EGLN3^−/− MEFs transduced with Lenti-EGLN3-WT, but not Lenti-EGLN3-p.His196Arg mutant (Fig. 2g,h). Thus, EGLN3 hydroxylation activity regulates mitochondrial content under these conditions. Next, we asked whether changes in mitochondrial content observed in some tissues of EGLN3-constitutive KO mice would culminate in an exercise intolerance phenotype, a common feature in settings of decreased mitochondrial biogenesis. Thus, we analysed exercise endurance in younger and older EGLN3 mice using a treadmill running test. We observed a minor but significant impairment in exercise capacity in older EGLN3^−/− males (56–60 weeks; Fig. 2i), but not in younger males aged 18–19 weeks of age (Extended Data Fig. 2i). Thus, the decreased mitochondrial content observed in certain tissues does not seem to have an impact on the exercise capacity of younger mice, but might play a more indirect role during ageing.

TFAM hydroxylation on proline 53/66 causes pVHL recognition

To understand the mechanism of how pVHL can regulate mitochondrial content depending on EGLN3 hydroxylation activity, we investigated regulators of mitochondrial biogenesis, a process by which cells increase their individual mitochondrial mass and copy. Mitochondrial biogenesis is largely coordinated by PGC1α²⁸, which in turn regulates the activity of TFAM, a key activator of mitochondrial transcription and mitochondrial genome replication²⁹. pVHL and EGLN3 restored TFAM protein abundance in VHL-null cells (Fig. 1e,i and Fig. 3a) and in EGLN3^−/− cells (Fig. 2g,h), respectively, whereas PGC1α protein abundance remained unaffected (Fig. 3a). Because TFAM is localized at the mitochondria, we performed mitochondrial fractionation and found that both, pVHL and EGLN3, partially localized to the mitochondria (Fig. 3b), consistent with previous reports³⁰. Interestingly, the VHL^L188V type 2C mutation was barely detected in the mitochondria fraction (Fig. 3b). To validate that pVHL and EGLN3 are localized within the mitochondria, we performed proteinase K digestion to exclude proteins at the mitochondrial outer membrane. This allows the detection of proteins within the inner membrane or matrix only (Fig. 3c and Extended Data Fig. 3a). In VHL-expressing 786-O cells, pVHL was detected both in the cytosol, and also within the mitochondria after proteinase K digestion (Fig. 3c). In addition, we could also detect endogenous EGLN3 and pVHL within the mitochondria after proteinase K digestion (Extended Data Fig. 3a).

**Fig. 3: pVHL regulates TFAM protein stability depending on EGLN3 enzymatic activity.**

To investigate direct binding of pVHL with endogenous TFAM within the mitochondria in intact cells, we performed proximity ligation assays (PLAs) combined with mitochondrial staining. We detected PLA fluorescence signal caused by endogenous TFAM binding to pVHL in VHL-expressing 786-O cells, but not in VHL-null cells (Fig. 3d,e and Extended Data Fig. 3b–d). We visualized PLA fluorescence signal with standard maximum intensity projection and further used spatial resolution with an orthogonal view to the projection axis to validate mitochondrial localization (Fig. 3d,e and Extended Data Fig. 3b–d).

To further explore whether prolyl hydroxylation of TFAM by EGLN3 is responsible for the pVHL-dependent regulation of TFAM abundance, we first investigated if pVHL interacts with endogenous TFAM in 786-O cells expressing HA-VHL. TFAM was readily detected in anti-HA immunoprecipitates of cells expressing HA-VHL unless EGLN3 (but not EglN1 or EglN2) was downregulated with an effective shRNA (Fig. 3f). Furthermore, TFAM co-immunoprecipitated only with wild-type VHL, but not with VHL^L188V type 2C mutant (Fig. 3g). Moreover, when 786-O cells were treated with the protein synthesis inhibitor cycloheximide, the half-life of TFAM was shorter in VHL^−/− cells compared to wild-type VHL-expressing cells (Fig. 3h). Similarly, the half-life of TFAM was shorter in EGLN3^−/− KO MEFs compared to wild-type MEFs (Fig. 3i), indicating that pVHL and EGLN3 stabilize TFAM protein.

To test whether prolyl hydroxylation is responsible for the VHL-dependent regulation of TFAM protein abundance, we investigated if TFAM could be hydroxylated by EGLN3 and subsequently recognized by pVHL. Myc was immunoprecipitated from in vitro translated (IVT) full-length TFAM-myc, which was then used in EGLN3 hydroxylation assays. TFAM-myc captured ³⁵S-labelled pVHL after incubation with EGLN3 wild type, but not with a catalytically impaired p.His196Arg EGLN3 mutant (Fig. 4a). Furthermore, a pan-hydroxyproline antibody immunoprecipitated Flag-TFAM from 293 cells that exogenously expressed EGLN3 unless the EGLN3 was catalytically inactive or the cells were treated with DMOG (Fig. 4b). Hydroxyproline antibody immunoprecipitation of Flag-TFAM was not detected with exogenously expressed EGLN1 or EGLN2 (Extended Data Fig. 4a).

**Fig. 4: TFAM is hydroxylated by EGLN3 at proline 53/66 causing pVHL recognition.**

Recent reports demonstrated that phosphorylation within the HMG1 (high mobility group 1) domain of TFAM by protein kinase A (PKA) promotes its degradation by the mitochondrial LONP1 protease^31,32. Since we observed that EGLN3 is responsible for the pVHL-dependent TFAM stabilization, we generated a 40-amino-acid peptide (TFAM 31–70) spanning the HMG1 domain containing the PKA phosphorylation sites (Fig. 4c) to identify potential hydroxylation residues. Proline hydroxylation was assayed by ³⁵S-VHL capture and confirmed by LC–MS/MS analysis (Fig. 4c–f). TFAM peptide 31–70 captured ³⁵S-VHL after the EGLN3 hydroxylation reaction, but not after the hydroxylation reaction with the p.His196Arg EGLN3 catalytically impaired mutant (Fig. 4d). This was a specific function of EGLN3 among the EGLN paralogues (Fig. 4d), consistent with our earlier observations that regulation of TFAM abundance (Fig. 2b and Extended Data Fig. 2b) and hydroxyproline antibody immunoprecipitation of TFAM (Extended Data Fig. 4a) is a distinguishing feature of EGLN3. Hydroxylation of the TFAM peptide 31–70 was confirmed by LC–MS/MS analysis (Fig. 4e,f and Extended Data Fig. 4b–f). MS confirmed that EGLN3 catalyses the hydroxylation of proline 53 and proline 66 (Fig. 4e,f and Extended Data Fig. 4b,c). We detected mono-hydroxylated peptide on either proline 53 or proline 66 (Extended Data Fig. 4d,e). The detected intensity of each proline-hydroxylated peptide was quantified and normalized to the non-hydroxylated peptide (Extended Data Fig. 4f). To understand the importance of mono-hydroxylation or potential di-hydroxylation of the respective proline residues for pVHL binding, we synthesized TFAM peptide 31–70 peptides with the proline-to-alanine substitutions p.Pro50Ala, p.Pro53Ala, p.Pro66Ala and p.Pro53/66Ala, and measured their hydroxylation by EGLN3 using the ³⁵S-VHL capture assay (Fig. 4g). The p.Pro50Ala proline substitution did not alter hydroxylation relative to the wild-type peptide. In contrast, the p.Pro53Ala and p.Pro66Ala substitutions significantly impaired ³⁵S-VHL capture and the double substitutions p.Pro53/66Ala completely abolished ³⁵S-VHL recognition (Fig. 4g). In a reciprocal experiment, we synthesized TFAM peptide 31–70 in which both prolines 53 and 66 (P-OH-53/66) were hydroxylated (Extended Data Fig. 4g). As expected, hydroxylated peptide could, similarly to the hydroxylated HIF1α peptide (556–575), capture ³⁵S-VHL (Fig. 4h). In contrast, non-hydroxylated TFAM peptide (naïve) did not capture ³⁵S-pVHL. Our finding that TFAM expression can be restored by wild-type VHL, but not type 2C VHL mutants (Figs. 1e,i and 3a), suggested that the latter cannot recognize hydroxylated TFAM. Indeed, type 2C pVHL mutants bound to hydroxylated HIF1α and HIF2α peptides, but failed to bind hydroxylated TFAM peptide (P-OH-53/66; Fig. 4h,I). Type 1, 2A and 2B pVHL mutants also failed to recognize hydroxylated TFAM (Fig. 4h,i). Next, we tested the pVHL^R200W Chuvash mutation in the ability to bind hydroxylated TFAM. VHL^R200W has been identified in homozygous carriers with a congenital erythrocytosis (Chuvash polycythaemia) but with a total absence of tumour development^22,23,24. In contrast to the VHL cancer syndrome mutations, hydroxylated TFAM peptide captured ³⁵S-VHL^R200W mutant similarly to ³⁵S-VHL wild type (Fig. 4i). However, HIF1α-P-OH and HIF2α-P-OH peptides were both partially impaired to capture ³⁵S-VHL^R200W (Extended Data Fig. 4h), confirming previous reports of partial altered HIFα signalling in Chuvash patients^22,23,24,33. Thus, type 1, 2A, 2B and 2C pVHL mutations tested all failed to bind hydroxylated TFAM, regardless of whether they have the ability to bind hydroxylated HIFα or not. In contrast, pVHL^R200W polycythaemia mutation bound hydroxylated TFAM similarly to wild-type VHL. In addition, we noticed that the type 2A pVHL^Y98H mutant associated with low risk ccRCC behaved similarly to pVHL^R200W Chuvash mutant being partially, but not fully impaired in HIF2α-P-OH peptide binding, reinforcing the role of HIF2α as oncogenic driver in ccRCC (Extended Data Fig. 4h).

Next, we complemented these studies by expressing wild-type or mutant HA-pVHL in 786-O cells and performing pulldown assays with immobilized TFAM or HIF2α peptide. As expected, wild-type HA-VHL and Chuvash HA-VHL^R200W mutant bound similarly to the dihydroxy-TFAM peptide (P-OH-53/66), but not to any VHL syndrome mutants (Fig. 4j and Extended Data Fig. 4i), confirming the IVT ³⁵S-VHL capture assay (Fig. 4i). In contrast to TFAM binding and consistent with the ³⁵S-VHL capture assay (Fig. 4i), HA-VHL^R200W capture to hydroxylated HIF2α peptide was partially impaired (Fig. 4j).

In summary, we observed that all tested VHL syndrome mutations failed to recognize hydroxylated TFAM. In contrast, the VHL-Chuvash polycythaemia mutant had similar binding affinity as wild-type VHL to hydroxylated TFAM, but was impaired in binding hydroxylated HIFα.

pVHL binding to hydroxylated TFAM protects from LONP1 degradation

We observed that the half-life of TFAM protein was shorter in VHL^−/− or EGLN3^−/− cells compared to cells expressing VHL or EGLN3, demonstrating that pVHL and EGLN3 stabilize TFAM protein (Fig. 3h,i). Recent reports demonstrated that phosphorylation of TFAM by PKA promotes its degradation by the mitochondrial LONP1 protease^31,32. Thus, we hypothesized that binding of pVHL to hydroxy-P53/P66-TFAM masks S55/S56 phosphorylation and LONP1 recognition site and thus prevents degradation by LONP1. First, we used the LONP1 protease inhibitor bortezomib to determine if low TFAM abundance in EGLN3^−/− primary MEFs and VHL-null 786-O cells was due to protease degradation. Bortezomib increased TFAM protein abundance in EGLN3^−/− MEFs to the level of EGLN3^+/+ MEFs (Fig. 5a). Likewise, bortezomib treatment of VHL^−/− cells (786-O) restored TFAM levels (Fig. 5b), providing evidence that loss of either EGLN3 or VHL accelerates TFAM degradation. In addition, we observed that exogenous expression of inducible TFAM-p.Pro53Arg/p.Pro66Arg mutant in HEK293 cells was robustly decreased compared to TFAM wild type (Fig. 5c). As shown earlier, TFAM-p.Pro53Arg/p.Pro66Arg mutant peptide failed to capture S35-VHL (Fig. 4g). We predict that TFAM-p.Pro53Arg/p.Pro66Arg protein can no longer bind pVHL, and therefore can be targeted by PKA phosphorylation and rapid LONP1 degradation. Thus, we investigated further if PKA phosphorylation of hydroxylated TFAM peptide is impaired by VHL binding. Preincubation with GST-VHL prevented the hydroxylated TFAM peptide from PKA binding and phosphorylation (Fig. 5d). Consistent with these results, we observed that PKA activation using forskolin in HA-VHL-WT-expressing cells (786-O) decreased TFAM protein to a similar level as observed in VHL-null cells (Fig. 5e). In a reciprocal experiment using the PKA inhibitor H89 in 786-O cells, we observed increased TFAM protein abundance in VHL-null cells to a similar level as observed in HA-VHL-WT-expressing cells (Fig. 5f).

**Fig. 5: pVHL protects TFAM from LONP1 degradation.**

Next, we tested the hypothesis that free TFAM (not bound to mitochondrial DNA) is resistant to LONP1 degradation when bound to VHL. Purified TFAM and LONP1 were incubated with ATP/Mg²⁺ causing TFAM to be rapidly degraded (Fig. 5g). In contrast, when purified TFAM was hydroxylated by EGLN3 and subsequently incubated with purified GST-VHL before LONP1 incubation, TFAM became resistant to LONP1 degradation (Fig. 5g). Hydroxylation assay with a catalytically dead p.His196Arg EGLN3 mutant, however, impaired GST-VHL binding and TFAM was rapidly degraded by LONP1 despite incubation with GST-VHL.

Thus, we conclude that binding of pVHL to hydroxylated TFAM prevents TFAM from LONP1 recognition and degradation and thus allows free TFAM protein to stabilize in the absence of mitochondrial DNA binding.

LONP1 inhibition sensitizes VHL-null clear cell renal cell carcinoma cells to sorafenib

The decrease of mitochondrial content observed in the VHL mutated PPGL and ccRCC cells (Fig. 1) suggests that mitochondrial content is a pathogenic target within the VHL cancer syndrome. Indeed, high expression of either catalytic subunit of PKA (PRKACA) or LONP1 that facilitates TFAM degradation was associated with shorter overall survival of individuals with ccRCC (Fig. 5h,i). Thus, we hypothesized that the decreased mitochondrial content in ccRCC might contribute to therapy resistance and contribute to lower overall survival in these individuals. VHL-null 786-O cells were resistant to apoptosis in contrast to VHL wild-type-expressing cells when treated with sorafenib (Fig. 5j,k). Sorafenib is a kinase inhibitor approved for the treatment of primary kidney cancer, advanced primary liver cancer, acute myeloid leukaemia and advanced thyroid carcinoma. Indeed, VHL-null cells pretreated with LONP1 inhibitor bortezomib were re-sensitized to sorafenib and underwent complete apoptosis similar to VHL wild-type-expressing cells (Fig. 5j,k). This suggests that the low level of mitochondrial content might contribute to therapy resistance.

To examine if VHL-null ccRCC can be re-sensitized to sorafenib treatment in vivo, we subcutaneously transplanted VHL-null 786-O cells into immunocompromised SCID mice. After approximately 4 weeks of tumour growth, mice were treated with DMSO (control), sorafenib (15 mg per kg body weight), bortezomib (1 mg per kg body weight), or with combination of both, sorafenib and bortezomib (Fig. 5l,m). Treatment with sorafenib or bortezomib alone did not significantly inhibit tumour growth compared with control treatment (Fig. 5l,m); however, combination treatment with sorafenib and bortezomib resulted in significant inhibition of tumour growth compared with single or control treatment (Fig. 5l,m), recapitulating our in vitro cell culture observation (Fig. 5j,k). Immunofluorescence stainings confirmed that combination treatment resulted in increased TFAM and mitochondrial protein MTCO2 (Fig. 5n). Collectively, these results indicate that VHL-null ccRCC cells are sensitized to sorafenib when combined with LONP1 inhibitor bortezomib, leading to a profound tumour growth defect in vivo that was associated with increased levels of mitochondrial content.

VHL restores oxygen consumption independent of HIFα

We observed that mitochondrial mass can be restored by wild-type VHL, but not type 2C VHL mutants that are normal regarding HIFα regulation (Fig. 1f). Thus, we tested if the restored mitochondrial content resulted in functional mitochondria and increased cellular oxygen consumption rate (OCR). Compared to 786-O VHL-null cells, overall respiration was significantly increased in 786-O cells stably expressing wild-type VHL, but not in cells expressing type 2C VHL mutants (Fig. 6a and Extended Data Fig. 5a), indicating that VHL can restore mitochondrial function independent of HIFα regulation. Glycolysis and glycolytic capacity measured by extracellular acidification rate (ECAR) in VHL type 2C cells was, however, in between VHL-null and VHL wild-type cells, suggesting that activation of HIFα in VHL-null cells additionally contributes to increased glycolysis (Extended Data Fig. 6a).

**Fig. 6: pVHL restores cellular oxygen consumption rate.**

Consistent with our findings that pVHL-mediated regulation of mitochondrial mass is EGLN3 dependent (Fig. 2b–d), cellular respiration was impaired in VHL-expressing 786-O cells after inactivation of EGLN3 by an effective shRNA (Fig. 6b and Extended Data Fig. 5b).

Consistent with these observations, glycolysis was increased after inactivation of EGLN3 by shRNA (Extended Data Fig. 6b). Furthermore, OCR was impaired (Fig. 6c and Extended Data Fig. 5c) and glycolysis was increased (Extended Data Fig. 6c) in primary EGLN3^−/− MEFs (passage 5) compared to control EGLN3^+/+ MEFs. This was dependent on EGLN3 enzymatic activity, as respiration was restored in EGLN3^−/− MEFs that were transduced with wild-type EGLN3 (lenti-EGLN3-WT), but not when transduced with catalytically inactive mutant (lenti-EGLN3-H196A; Fig. 6d and Extended Data Figs. 5d and 6d).

To test if the low mitochondrial content in VHL-null cells will result in a glycolytic dependency to maintain energy homeostasis, we performed glucose deprivation or glycolysis inhibition and measured the ADP:ATP ratio, a central parameter of cellular energy metabolism (Fig. 6e–p). The 786-O cells expressing VHL wild type were resistant to glucose deprivation-induced cell death, compared to VHL-null cells or cells expressing VHL type 2C, 2B, 2A or type 1 mutants (Fig. 6e and Extended Data Fig. 5e). Similar results were observed inhibiting glycolysis using hexokinase inhibitor (3-bromopyruvatic acid (3-BP)) or lactate dehydrogenase inhibitor gossypol (Fig. 6f,g). Glycolytic dependency was similarly observed in EGLN3-null cells (Extended Data Fig. 5f–h). Furthermore, an unbalanced ADP/ATP ratio was significantly induced after glucose deprivation or glycolysis inhibition in VHL-null or type 2C mutant cells but not in VHL wild-type-expressing cells, indicating a cellular response to energy crisis (Fig. 6h–j). Since PKA inhibitor (H89) restored TFAM expression in VHL-null cells, we explored if PKA inhibition can restore resistance to glycolysis inhibition in VHL-null cells. Similarly to cells expressing wild-type VHL, VHL-null cells showed resistance to glucose deprivation and glycolysis inhibition when pretreated with PKA inhibitor, and the ADP/ATP ratio was restored (Fig. 6k–p).

In summary, 786-O cells lacking VHL or expressing type 2C VHL mutants depend on glycolysis to obtain energy. Restoring wild-type VHL or pretreating cells with PKA inhibitor restores mitochondrial content and function and promotes metabolic reprogramming to oxidative phosphorylation and thus reverses vulnerability to glycolysis inhibition-induced cell death.

Low mitochondrial content causes impaired differentiation

It has been recently demonstrated that metabolic reprogramming from aerobic glycolysis to oxidative phosphorylation is tightly coupled to differentiation, although the exact molecular basis underlying the transition is unknown^34,35. Thus, we asked if type 2C VHL cancer mutations contributing to low mitochondrial content can impair differentiation in pheochromocytoma PC12 cells. PC12 cells have been used as a model to study differentiation by nerve growth factor (NGF)³⁶. PC12 cells resemble differentiated sympathetic neurons when grown under low-serum conditions in the presence of NGF³⁷ (Fig. 7a,b). Neurite outgrowth and the induction of neuron-specific class III beta-tubulin (Tuj1) was evident within 6 d of NGF culture condition. Differentiation was accompanied by induction of mitochondrial mass measured by MitoTracker staining and induction of TFAM protein (Fig. 7a,b). Next, we generated stable PC12 cells expressing either human HA-VHL wild-type or type 2C VHL mutants and subsequently transduced cells with an effective shRNA silencing endogenous rat VHL (Extended Data Fig. 7a). Control cells (shSCR) grown in the presence of NGF differentiated as evidenced by neurite outgrowth and Tuj1 induction. However, cells transduced with an effective shRNA inactivating endogenous rat VHL (sh-ratVHL) failed to respond to NGF-mediated differentiation (Fig. 7c). In contrast, cells with restored expression of human HA-VHL fully rescued the differentiation induced by NGF as evident by neurite outgrowth, Tuj1 induction and induction of mitochondrial content. In contrast, cells restored with HA-VHL-p.Leu188Val type 2C mutant showed no differentiation-associated phenotypic changes or induction of Tuj1 or mitochondrial content (Fig. 7c and Extended Data Fig. 7a). Similarly to inactivation of VHL, inactivation of TFAM following transduction with an effective shRNA, PC12 cells showed no characteristics of phenotypical changes associated with NGF-induced differentiation (Fig. 7d,e), indicating that low mitochondrial content prevents neural differentiation induced by NGF.

**Fig. 7: Low mitochondrial content in pheochromocytoma cells causes impaired differentiation.**

Discussion

Functional mitochondria are essential for the cell energy metabolism of most tumour types. At the same time, mutations in genes impairing oxidative phosphorylation causing defects in mitochondrial energy metabolism have been reported for a restricted subset of tumours such as succinate dehydrogenase in hereditary PPGL, RCC and gastrointestinal stromal tumours³⁸, fumarate hydratase in hereditary leiomyomatosis and RCC³⁹ and isocitrate dehydrogenase 1 (IDH1) and IDH2 in secondary glioblastomas and acute myeloid leukaemia^40,41. Here, we observed that all tested VHL cancer syndrome mutations (type 1 and type 2A, 2B and 2C), but not the VHL^R200W Chuvash polycythaemia mutation, are impaired in regulating TFAM abundance and contribute to decreased mitochondrial mass (Fig. 8). Patients with VHL^R200W mutation causing Chuvash polycythaemia are reported to show total absence of tumour development despite increased HIFα signalling^22,23,24. Thus, alterations in mitochondrial biogenesis might play a role in initiating and/or sustaining the transformed state, independent of HIFα oncogenic functions. In this regard, we found that low mitochondrial content in pheochromocytoma cells (PC12) expressing type 2C VHL mutants prevented NGF-induced differentiation. Type 2C VHL mutations were clearly defective in binding hydroxylated TFAM and failed to restore mitochondrial content, despite their ability to suppress HIFα. Impaired mitochondrial biogenesis caused by germline VHL syndrome mutations might impair differentiation of a progenitor cell during embryonic development, independent of HIFα. In this regard, in most affected VHL carriers, the disease displays an autosomal dominant pattern of inheritance^42,43. This is in contrast with gain-of-function HIF2α mutations that are observed in only few sporadic cases of PPGL and have not been detected to date in ccRCC^6,7,8. Although HIF2α is considered to be an oncogenic driver in VHL-related ccRCC, familial gain-of-function HIF2a mutations have only been reported to be associated with familial erythrocytosis⁴⁴. Similarly to VHL-Chuvash polycythaemia, patients with familial gain-of-function HIF2α mutation had no history of RCC, PPGL or central nervous system HB, the hallmarks of the VHL syndrome. This suggests additional pVHL tumour-suppressor functions outside HIFα regulation and implies that activation of HIFα might be necessary, but not sufficient for driving tumorigenesis in the VHL cancer syndrome (Fig. 8a). Furthermore, recent data show that VHL-related ccRCC can be classified into HIF2α-dependent and HIF2α-independent tumours and that these tumours differ in HIF2α levels and in their gene expression⁴⁵. These observations also point to HIF-independent mechanisms of tumorigenesis downstream of pVHL and thus may underlie differences in responsiveness to HIF2a inhibitor⁴⁵.

**Fig. 8: Schematic of oxygen-dependent regulation of mitochondrial content within the von Hippel–Lindau syndrome.**

Non-cancerous VHL^R200W Chuvash polycythaemia mutation was normal with regard to TFAM regulation in contrast to all other VHL syndromic cancer mutations, which suggests that impaired mitochondrial biogenesis is an important feature of the VHL syndrome (Fig. 8a). Low mitochondrial content could provide an energetic vulnerability for all tumour types arising in the VHL syndrome, including type 2C PPGL. In this regard, we observed that VHL-null ccRCC cells or cells expressing type 2C VHL mutations are highly dependent on glycolysis to maintain energy homeostasis and undergo rapid cell death when treated with glycolysis inhibitors. Efforts to target glucose uptake or lactate production, however, have been limited due to toxicity associated with hypoglycaemia symptoms⁴⁶.

Advanced ccRCC is a lethal disease with a 5-year survival of only 11.7%⁴⁷, and traditional chemotherapy and radiation therapy are largely ineffective. We hypothesized that the low mitochondrial content in ccRCC might contribute to the known therapy resistance in ccRCC. VHL-null 786-O cells were resistant to apoptosis in contrast to VHL wild-type-expressing cells when treated with sorafenib, a multi-kinase inhibitor approved for the treatment of primary kidney cancer. By understanding the precise molecular mechanism by which pVHL regulates mitochondrial mass, we performed pharmacological studies to increase mitochondrial content in VHL-deficient ccRCC cells. pVHL binding to hydroxylated TFAM, a key activator of mitochondrial transcription and replication, stabilizes TFAM by preventing LONP1 recognition and subsequent mitochondrial proteolysis (Fig. 8b). VHL-null ccRCC cells responded to LONP1 inhibitor bortezomib, causing an increase of mitochondrial content and re-sensitized cells to sorafenib. Combined treatment of both sorafenib and bortezomib provided a profound tumour growth defect in vivo. Thus, LONP1 inhibition provides a pharmacological tool to increase mitochondrial content in VHL-deficient ccRCC and can sensitize therapy-resistant ccRCC cells to sorafenib.

Methods

Ethical considerations

Collection and analyses of human samples (normal adrenal tissues, PPGL) are covered by the ethical approval numbers 01-136, KI forskningsetikkommitté Nord and 2020-04226. All samples were obtained following an informed patient consent. Ethical permits for animal studies were approved by the appropriate local and national authorities (Jordbruksverket, Sweden).

Cell culture

Human renal carcinoma cell lines 786-O (American Type Culture Collection (ATCC), CRL-1932) and A498 (ATCC, HTB-44), HeLa cells (ATCC, CCL-2), 293FT cells (Thermo Fisher, R70007) and MEFs were cultured in DMEM (glucose 4.5 g l⁻¹) containing 10% FBS in 5% CO₂ at 37 °C. VHL^fl/fl and EGLN3^−/− primary MEFs⁴⁸ and isolation of primary MEFs⁴⁹ have been described previously. 786-O cells were purchased from the ATCC. Rat PC12 cells (ATCC, CRL-1721) were differentiated with 50 ng ml⁻¹ NGF in DMEM medium (glucose 1 g l⁻¹) supplemented with 1% horse serum. Before differentiation, stable polyclonal PC12 cells expressing the indicated human VHL (huVHL) species were selected with G418 (0.5 mg ml⁻¹) for 2 weeks. PC12 clones were transduced for 48 h with lentivirus encoding shRNA targeting endogenous rat VHL (sh-ratVHL) or scramble control (shSCR) and subsequently treated with NGF for 6 d.

EGLN3-knockout mice

Generation of the EGLN3 mouse strain (C57BL/6) has been previously described⁴⁸. Animal experiments were performed in accordance with Swedish animal welfare laws authorized by the Stockholm Animal Ethics Committee (7694/17). P1 SCG dissections of EGLN3 pups are described in ref. ⁵⁰. Mice were housed in individually ventilated cages with free access to food and water in constant temperature (20 ± 3 °C) and humidity (50% ± 10%). Light/dark cycle was 12 h:12 h from 06.00 to 18.00 and 12 h of darkness with dusk and dawn periods in between. The mice received standard diet from Special Diets Services CRM (P; 9.5 mm pelleted; 801722).

Human tissue specimens

Tumour tissue samples (PCC n = 9 and PGL n = 1) were collected from individuals at the Karolinska University Hospital, Stockholm, Sweden, and previously characterized for mutations in PPGL susceptibility genes⁵¹ (Extended Data Fig. 2). All samples were obtained with informed patient consent and with approval from the local ethical committees. VHL mutations in cases 21, 25, 96 and 108 as well as WT-VHL status for the other six cases have been previously described⁵¹.

Confocal microscopy

MEFs and 786-O cells were cultured on glass coverslips and stained with MitoTracker Red CMXRos (100 nM) at 37 °C for 30 min, washed twice with pre-warmed PBS, and fixed for 15 min in pre-warmed 4% paraformaldehyde. Coverslips were immersed into PBS overnight, and mounted using ProLong Diamond Antifade Mountant with DAPI (Thermo Fisher, P36962). Fluorescence images were acquired using a Zeiss LSM 700 laser scanning confocal microscope equipped with a ×63 Plan-Apochromat/1.4-NA Oil with DIC capability objective. The excitation wavelengths for MitoTracker Red CMXRos and DAPI were 579 nm and 405 nm, respectively. Images were acquired using the settings: frame size of 1,024, scan speed of 6 and 12-bit acquisition and line averaging mode of 8. Pinholes were adjusted so that each channel had the same optical slice of 1–1.2 μm.

Flow cytometry analysis

786-O or MEFs cells were stained with MitoTracker Green FM (100 nM) at 37 °C for 30 min for labelling mitochondria. Mean fluorescence intensity analysis of labelled mitochondria was performed by gating on single cells (see FACS gating strategies in Supplementary Fig. 1). Samples were analysed on an LSRFortessa flow cytometer (BD Biosciences) and analysed using FlowJo software (Tree Star). Cell apoptosis rate was detected by annexin V-FITC/PI staining. After 48 h of treatment, the 786-O cells were rinsed with PBS and collected for annexin V-FITC/PI staining. Each cell pellet was resuspended in 500 μl of binding buffer supplemented with 5 μl of FITC and 5 μl of PI, and the cells were incubated for 15 min. The apoptotic ratios were determined by flow cytometry.

Graded treadmill running test

All treadmill running experiments were approved by the regional animal ethics committee of Northern Stockholm (4039-2018 and 4359-2020) and mice were housed as described above. Male mice aged 58–60 weeks old (wild type n = 15, KO n = 16) and young males 18–19 weeks old (wild type n = 16 and KO n = 16) were used. Acclimation to treadmill was performed with male wild-type and EGLN3^−/− mice of the indicated ages for 3 d before the experiment by running 10 min per day. Each day, mice started with 5 min at a speed of 6 m min⁻¹. On day 1, this was followed by 5 min at 9 m min⁻¹. On day 2, this was followed by 2 min at 9 m min⁻¹, 2 min at 12 m min⁻¹ and 1 min at 6 m min⁻¹. On day 3, this was followed by 2 min at 9 m min⁻¹, 2 min at 15 m min⁻¹ and 1 min at 6 m min⁻¹. The graded treadmill running test was performed on a 10° slope. During the test, the speed was increased every 3 min up to a maximum of 35 m min⁻¹. Exhaustion time was determined when the animal could no longer continue running despite gentle prodding. Body weight was recorded after exhaustion to calculate work and power.

Mouse tumour models and treatment

Mouse tumour xenograft models were approved by the Swedish Board of Agriculture (ethical no. 6197-2019). Male CB17/Icr-Prkdc^scid/Rj mice aged 6–8 weeks old were purchased from Janvier Labs (France). Mice were housed in individually ventilated cages with free access to food and water in constant temperature (20 ± 3 °C) and humidity (50% ± 10%). Light/dark cycle was 12 h:12 h from 06.00 to 18.00 and 12 h of darkness with dusk and dawn periods in between. The mice received standard diet from Special Diets Services CRM (P; 9.5 mm pelleted; 801722). They were randomly divided into each group. Approximately 5 × 10⁶ 786-O tumour cells were subcutaneously injected into the back along the middorsal line of each mouse. Tumour volume was measured every 3 d and calculated according to the standard formula: length × width² × 0.52. Drug treatment was initiated when tumour volume reached 5 mm³. DMSO (1%; STBJ9836, SIGMA) and sorafenib (15 mg per kg body weight, SML2653, Sigma-Aldrich) were orally delivered to mice every day. Bortezomib (1 mg per kg body weight; 3514175, Merck) was intraperitoneally injected twice per week in either monotherapy or combination therapy. The experiment terminated when the tumour volume of the 1% DMSO group reached 1.2–1.3 cm³. The maximal tumour size permitted by the ethics committee was 2.5 cm³ and the tumour size did not exceed the permitted tumour size.

Histology and immunofluorescence

Paraffin-embedded tissues were cut into 5-μm slides. Slides were baked for 1 h at 60 °C and deparaffinized in Tissue-Clear (1466, Sakura), and sequentially rehydrated in 99%, 95% and 70% ethanol and counterstained with H&E. Mounting was performed with Pertex (0081, HistoLab). Deparaffinized slides were boiled for 20 min in an unmasking solution (H3300, Vector Labs) then subsequently blocked with 4% serum. Tissues were incubated with a mouse anti-human mtTFA antibody (1:200 dilution; 119684, Abcam) and a mouse anti-human MTCO2 antibody (1:200 dilution; 110258, Abcam) at 4 °C overnight, followed by staining with a species-matched secondary Alexa Fluor 555-labelled donkey anti-mouse (1:400 dilution; A-31570, Thermo Fisher Scientific) and a DAPI (10236276001, Roche). Slides were mounted with Vectashield (H-1000, Vector Labs). Signals were detected by fluorescence microscope equipped with a camera (Nikon, DS-QilMC). Images were analysed using an Adobe Photoshop software (CC 2019, Adobe) programme.

Viruses

Lentiviruses encoding wild-type Flag-EGLN3 and catalytically dead Flag-EGLN3 with the p.His196Arg mutation (Flag-EGLN3-H196A) were generated via TOPO cloning using pLenti6.3 backbone from Invitrogen (Life Technologies).

Immunoblot analysis

The lysis of cell lines, mouse and human tissue was performed in EBC buffer (50 mM Tris at pH 8.0, 120 mM NaCl, 0.5% NP-40) containing phosphatase inhibitors (04906837001, Sigma) and protease inhibitors (11697498001, Roche Life Science). Proteins were quantified by Bradford assay, and samples containing equal protein amounts were immunoblotted using previously described methodology⁵². Quantification of western blots was performed by ImageJ (Supplementary Fig. 2)

Antibodies used were: rabbit monoclonal anti-TFAM (1:1,000 dilution; Cell Signaling Technology, 8076), rabbit polyclonal anti-PKA C-α (1:1,000 dilution; Cell Signaling Technology, 4782), rabbit monoclonal anti-PHD-2/Egln1 (1:500 dilution; Cell Signaling Technology, 4835), rabbit monoclonal anti-HIF2α (1:1,000 dilution; Cell Signaling Technology, 7096), rabbit polyclonal anti-TOM20 (1:2,000 dilution; Cell Signaling Technology, 13929), rabbit polyclonal anti-TFAM (1:1,000 dilution; Abcam, ab131607), mouse monoclonal anti-GAPDH (1:2,000 dilution; Abcam, ab8245), mouse monoclonal anti-OXPHOS (1:1,000 dilution; Abcam, ab110413), mouse monoclonal anti-MT-CO1 (1:1,000 dilution; Abcam, ab14705), rabbit polyclonal anti-MT-CO2 (1:1,000 dilution; Abcam, ab91317), rabbit polyclonal anti-MT-ND1 (1:1,000 dilution; Abcam, ab181848), rabbit polyclonal anti-MT-ATP6 (1:1,000 dilution; Abcam, ab192423), rabbit polyclonal anti-MT-CYB (1:1,000 dilution; Abcam, ab81215), rabbit polyclonal anti-LONP1 (1:1,000 dilution; Abcam, ab103809), rabbit polyclonal anti-tyrosine hydroxylase (1:1,000 dilution; Abcam, ab112), rabbit polyclonal anti-hydroxyproline (1:1,000 dilution; Abcam, ab37067, GR3215743-1 and GR3179915-1), rabbit monoclonal anti-cyclin D1 (1:1,000 dilution; Abcam, ab134175), rabbit polyclonal anti-HIF1α (1:500 dilution; Novus Biologicals, NB100-479), rabbit polyclonal anti-HIF2α (1:500 dilution; Novus Biologicals, NB100-122), mouse monoclonal anti-α-tubulin (1:2,000 dilution; Sigma-Aldrich, T5168), mouse monoclonal anti-HA (1:1,000 dilution; Sigma-Aldrich, H9658), rabbit polyclonal anti-flag (1:1,000 dilution; Sigma-Aldrich, F7425), mouse monoclonal anti-PGC1α (1:1,000 dilution; Millipore, ST1202), mouse monoclonal anti-VHL (1:500 dilution; BD Biosciences, 556347), mouse monoclonal anti-VHL (1:1,000 dilution; BD Biosciences, 564183), rabbit polyclonal anti-EGLN2 (1:500 dilution; Affinity Biosciences, DF7918), mouse monoclonal anti-TUJ1 (1:2,000 dilution, Covance, MMS-435P), mouse monoclonal anti-c-Myc (1:1,000 dilution; Thermo Fisher Scientific, 13-2500) and mouse monoclonal anti-p-Ser (16B4; 1:500 dilution; Santa Cruz Biotechnology, sc-81514).

Proteomics analyses by nanoLC–MS/MS

NanoLC–MS/MS including database search for protein identification and quantification were performed at the Proteomics Biomedicum core facility, Karolinska Institutet, Stockholm. For protein extraction, human tissues were homogenized and lysed in EBC buffer (50 mM Tris, pH 8; 0.5% NP-40 and 120 mM NaCl) and proteins in supernatant were precipitated with chilled acetone at −20 °C overnight. Proteins (50 µg) were solubilized in 1 M urea (Sigma-Aldrich), 50 mM ammonium bicarbonate in 10% acetonitrile (AcN) and reduced with dithiothreitol to a final concentration of 5 mM by incubation for 1 h at 25 °C and alkylated with iodoacetamide to a final concentration of 15 mM via incubation for 1 h at 25 °C in the dark. The excess iodoacetamide was quenched by adding an 10 mM dithiothreitol.

Digestion was performed with 1.5 µg trypsin (final enzyme-to-protein ratio of 1:30) at 37 °C overnight followed by additional proteolysis with 1 µg lys-C at 37 °C for 6 h. After acidification with formic acid (5% final concentration), the tryptic peptides were cleaned with C18 HyperSep Filter Plate (bed volume of 40 µl; Thermo Scientific) and dried in a speedvac (miVac, Thermo Scientific).

Tandem Mass Tag (TMT)-10plex reagents (Thermo Scientific) in 100-µg aliquots were dissolved in 30 µl dry AcN, scrambled and mixed with 25 µg digested samples dissolved in 70 µl of 50 mM TEAB (resulting in a 30% AcN final concentration), followed by incubation at 22 °C for 2 h at 450 rpm. The reaction was then quenched with 11 µl of 5% hydroxylamine at 22 °C for 15 min at 450 r.p.m. The labelled samples were pooled and dried in a speedvac (miVac, Thermo Scientific).

The TMT-labelled tryptic peptides were dissolved in 2% AcN/0.1% formic acid at 1 µg µl⁻¹ and 2-µl samples were injected in an UltiMate 3000 nano-flow LC system online coupled to an Orbitrap Fusion mass spectrometer (Thermo Scientific). Peptides were separated by chromatography using a 50-cm-long C18 EASY-Spray column (Thermo Scientific), and 4–26% AcN for 120 min, 26–95% AcN for 5 min and 95% AcN for 8 min at a flow rate of 300 nl min⁻¹. The mass spectrum ranged from a m/z of 375 to 1,600, acquired with a resolution of 120,000 (m/z of 200), followed by data-dependent HCD fragmentations of precursor ions with a charge state from 2+ to 7+, using 45 s of dynamic exclusion. The tandem mass scans were acquired with a resolution of 50,000, targeting 5 × 10⁴ions, setting isolation width to a m/z of 1.4 and normalized collision energy to 35%.

Protein identification and quantification

Protein identification and quantification were performed with Proteome Discoverer v2.3 with human Swiss-Prot protein databases (21,008 entries) using the Mascot 2.5.1 search engine (Matrix Science). Parameters used were up to two missed cleavage sites for trypsin, precursor mass tolerance of 10 ppm and 0.02 Da for the HCD fragment ions. Quantifications used both unique and razor peptides.

Pathway analysis

According to the fold change of the protein abundance in human VHL-mutant PPGL compared to VHL wild-type PPGL, the top 50 significantly upregulated and downregulated proteins (P value < 0.05, two-tailed unpaired t-test) were selected for protein network analysis. STRING v10.5 was used to map the top 50 upregulated and downregulated regulated proteins in human PCC/PGL tumours onto protein–protein interaction networks (https://string-db.org/) with a medium confidence threshold (0.4). To identify enriched GO terms and KEGG (Kyoto Encyclopedia of Genes and Genomes) pathways, in-built gene-set enrichment analysis with the whole genome background was used.

GO term enrichment in cellular components of significantly downregulated proteins (P value < 0.0001, two-tailed unpaired t-test) in VHL-null and VHL^L188V 786-O cells was performed using DAVID and plotted using REVIGO. GO term enrichment was performed using DAVID with the full human proteome supplied by DAVID used as the background list, and plotted to reduce redundancy using ReviGo. The size of the bubbles is indicative of the number of proteins annotated with that GO term; bubbles were colour coded according to significance.

In vitro hydroxylation of full-length TFAM and ³⁵S-VHL capture

In vitro hydroxylation and S³⁵ capture have been recently described²⁰. In short, Myc-TFAM, ³⁵S-HA-VHL, Flag-EGLN3 WT and Flag-EGLN3 catalytically dead mutant were synthesized by IVT reactions using TnT T7 Quick Master Mix and used as substrates. IVT was added to 300 μl hydroxylation reaction buffer and 100 μM iron chloride, 2 mM ascorbate and 5 mM 2-oxoglutarate. Next, 15 μl IVT EGLN3 was added to the hydroxylation reaction for 2 h at room temperature. Then, 500 μl EBC lysis buffer was used to stop the hydroxylation reaction and 15 μl IVT-synthesized ³⁵S-HA-VHL was added subsequently and incubated for 2 h. Myc-TFAM was immunoprecipitated with anti-c-Myc antibody overnight at 4 °C with rotation and captured with 70 μl (50% slurry) protein G beads. The beads pellet was washed five times with immunoprecipitation buffer (0.5% NP-40, 150 mM NaCl, 10 mM Tris-HCl). Immunoprecipitated protein complexes were eluted with Laemmli buffer, boiled and centrifuged. Supernatant was analysed by immunoblot or ³⁵S autoradiography (Fig. 4a).

Peptide synthesis

The following biotinylated peptides were synthesized by peptides&elephants:

Naïve TFAM: -SPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKA

TFAM-p.Pro50Arg mutant: -SPFSFVYLPRWFSSVLASCAKKPVSSYLRFSKEQLPIFKA

TFAM-p.Pro53Arg mutant: -SPFSFVYLPRWFSSVLASCPKKAVSSYLRFSKEQLPIFKA

TFAM-p.Pro66Arg mutant: -SPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLAIFKA

TFAM-p.Pro53/66Arg double mutant:

-SPFSFVYLPRWFSSVLASCPKKAVSSYLRFSKEQLAIFKA

Hydroxy-TFAM-P-OH-53/66:

-SPFSFVYLPRWFSSVLASCPKKP(OH)VSSYLRFSKEQLP(OH)IFKA

Naïve HIF1α: DLDLEMLAPYIPMDDDFQLR

Hydroxy-HIF1α-P-OH 564: DLDLEMLAP(OH)YIPMDDDFQLR

Naïve HIF2α: FNELDLETLAPYIPMDGEDFQLS

Hydroxy-HIF2α-P-OH 531: FNELDLETLAP(OH)YIPMDGEDFQLS

TFAM peptide hydroxylation and ³⁵S-VHL capture

Peptide hydroxylation and ³⁵S-VHL capture (Fig. 4d) were performed as described above²⁰. In short, HA-EGLN1, HA-EGLN2, HA-EGLN3 AND HA-EGLN3 catalytically dead p.His196Arg mutant were synthesized by IVT using TnT T7 Quick Master Mix. Naïve biotin-TFAM peptide (1 μg) was conjugated with Streptavidin agarose beads (GE Healthcare Life Sciences) in 1 ml PBS at room temperature. The beads pellet was washed twice with PBS and once with hydroxylation buffer (40 mM HEPES, pH 7.4, 80 mM KCl) and resuspended with 300 μl hydroxylation reaction buffer. A total of 15 μl of IVT-synthesized HA-EGLN was added to the hydroxylation reaction and rotated for 2 h. Then, 500 μl EBC buffer and 15 μl IVT-synthesized S³⁵ radioactive-labelled HA-VHL was added and incubated overnight at 4 °C. Samples were centrifuged and washed five times with immunoprecipitation wash buffer. Bound peptide/protein complexes were eluted with 30 μl Laemmli buffer, boiled and centrifuged. Bound ³⁵S-HA-VHL was eluted by boiling in SDS-containing sample buffer, resolved by PAGE and detected by autoradiography.

Mass spectrometry analysis for peptide hydroxylation

The hydroxylation assay with TFAM peptide and EGLN3 (Fig. 4c–f) was performed as described above and processed as recently described⁵³. In short, after hydroxylation assay, beads conjugated to TFAM peptide were washed once with hydroxylation buffer and three times with IP buffer without detergent. Peptides were digested with trypsin and directly analysed by MS on a Q-Exactive mass spectrometer connected to an UltiMate 3000 chromatography system as recently described²⁰.

S³⁵VHL-mutant capture with hydroxylated hydroxy-TFAM-P-OH-53/66

The following biotinylated peptides were used for ³⁵S-VHL-mutant capture (Fig. 4h,i and Extended Data Fig. 4h):

hydroxy-TFAM-P-OH-53/66, hydroxy-HIF1α-P-OH 564 and hydroxy-HIF2α-P-OH 531.

Peptides were rotated for 1 h at room temperature and samples were subsequently washed twice with PBS. ³⁵S-VHL produced by IVT was captured as previously described²⁰ and above.

HA-VHL pulldown using hydroxylated peptides in ccRCC

HA-VHL pulldown in ccRCC cells (Fig. 4j and Extended Data Fig. 3) was performed with the following biotinylated peptides: naïve TFAM and naïve HIF2α as control, hydroxy-TFAM-P-OH-53/66 and hydroxy-HIF2α-P-OH. First, peptides were conjugated with streptavidin beads and incubated with cell lysates for 4 h at 4 °C with rotation. Samples were then washed four times with immunoprecipitation washing buffer (0.5% NP-40, 150 mM NaCl and 10 mM Tris-HCl) and eluted with 30 μl Laemmli buffer, boiled for 5 min and centrifuged at 8,000g for 30 s. The resulting supernatant was subjected to immunoblot analysis.

TFAM degradation assay by LONP1

In total, 60 μl Dynabeads His-Tag Isolation & Pulldown (10103D) was incubated with purified His-TFAM (2 μM) for 1 h 30 min at room temperature with rotation. Meanwhile, Flag-EGLN3 WT and Flag-EGLN3-p.His196Arg catalytic dead mutant were synthesized by IVT as described above. His-TFAM conjugated beads were resuspended with 1 ml hydroxylation reaction buffer supplemented with 100 μM iron chloride, 2 mM ascorbate and 5 mM 2-oxolgutarate. Then, 75 μl unprogrammed reticulocyte lysate, IVT-synthesized wild-type EGLN3 or EGLN3-p.His196Arg mutant was added to start the hydroxylation reaction. The hydroxylation reaction was processed for 2 h at room temperature with rotation. Next, 1 μg HA-VHL was incubated with the reaction samples for 2 h at room temperature with rotation and the bound protein complexes were washed twice with distilled water and resuspended with 25 μl LONP1 degradation buffer containing 30 mM NaCl, 10 mM HEPES-potassium hydroxide buffer (pH 8.0), 2 mM magnesium chloride, 0.1 mg ml⁻¹ BSA, 4 mM ATP and 100 nM LONP1. The TFAM degradation assay by LONP1 was processed for 2 h at 37 °C. Bound protein complexes were eluted with 30 μl of Laemmli buffer, boiled for 5 min and centrifuged at 8,000g for 30 s. Eluted supernatant was analysed by immunoblotting.

Expression plasmids, shRNA, siRNAs and gRNA

pcDNA3 Flag-EGLN3, Flag-p.His196Arg mutant and pcDNA3-VHL including VHL-missense mutations have been described previously⁵⁴. Lentiviruses encoding FLAG-EGLN3 and FLAG-EGLN3-p.His196Arg were generated in 293FT cells (Thermo Fisher, R70007) as previously described⁴⁸. siRNAs targeting Egln1, Egln2 or Egln3 were generated with the following sequences: siEGLN1: (5′->3′): (AGCUCCUUCUACUGCUGCA)(UU); siEGLN2: (5′->3′): (GCCACUCUUUGACC-GGUUGCU)(UU); siEGLN3: (5′->3′): (CAGGUUAUGUUCGCCAC-GU)(UU). Lentiviruses encoding shRNAs targeting human EGLN1, EGLN2 and EGLN3 were generated using the pLKO.1 plasmid using the following sequences:

EGLN1 (5′-CCGGGACGACCTGATACGCCACTGTCTCGAGACAGGGCGTATCAGG-TCGTCTTTTT-3′);

EGLN2 (5′-CCGGCTGGGACGTTAAGGTGCATGGCTCGAGCCATGCACCTTAACG-TCCCAGTTTTT-3′);

EGLN3 (5′-CCGGGTTCTTCTGGTCAGATCGTAGCTCGAGCTACGATCTGACCAGA-AGAACTTTTTG-3′).

sgRNA (Sigma-Aldrich) sequences targeting EPAS1 or control were cloned into pLentiCRISPR-V2 (Addgene no. 52961, provided by the laboratory of J.H.).

sgEPAS1-EX2-T1-SS: 5ʹ-caccgGTGCCGGCGGAGCAAGGAGA-3ʹ,

sgEPAS1-EX2-T1-AS: 5ʹ-aaacTCTCCTTGCTCCGCCGGCACc-3ʹ;

sgEPAS1-EX2-T2-SS: 5ʹ-caccgGATTGCCAGTCGCATGATGG-3ʹ,

sgEPAS1-EX2-T2-AS: 5ʹ-aaacCCATCATGCGACTGGCAATCc-3ʹ,

sgCONTROL-SS: 5ʹ-caccgCTTGTTGCGTATACGAGACT-3ʹ,

sgCONTROL-AS: 5ʹ-aaacAGTCTCGTATACGCAACAAGc-3ʹ.

Generation of piggyBac vector expressing wild-type and mutant TFAM

TFAM wild-type and P53/66A mutant ORF CDS were PCR from pReciver-M07 (GeneCopoeia, EX-F0074-M09). Primers included were iTFAM-F:

5ʹ-GAATGGTCTCTCTAGCGCCGCCACCATGGCGTTTCTCCGAAGC-3ʹ;

iTFAM-R: 5ʹ-GAATGGTCTCTCGCGTTCACAGATCCTCTTCAGAGATGAGT-3ʹ (Integrated DNA Technologies). The PCR products and pB-TRE-empty or pB-TRE-Luc2-empty vectors (gifts from the laboratory of J.H.) were digested by NheI and MluI (New England Biolabs). After purification, the PCR products were ligated into the pB-TRE-empty or pB-TRE-Luc2-empty vector. Sequences were confirmed using the Sanger method (Integrated DNA Technologies).

Generation of stable and inducible TFAM expression in HEK293 cells

Transposon vectors pB-TRE-TFAM-wt-Luc2, pB-TRE-TFAM-mut-Luc2 and transposase vector pCAG-hyPBase were transfected at the ratio of 4:1 into HEK293 cells by Lipofectamine 2000 (Invitrogen) according to the manufacturer’s instructions. Two days later, cells were selected under 200 µg ml⁻¹ hygromycin B until the blank cells were 100% dead. Then 0.9 × 10⁵ cells were seeded into six-well dishes, and 100 ng ml⁻¹ doxycycline (Clontech) was added into the cells for 48 h before the cells were harvested for western blot.

Co-immunoprecipitation

One confluent p150 plate of 786-O cells stably expressing VHL (pPC3, WT-VHL, p.Leu188Val-VHL) or 786-O WT-VHL cells infected with lentivirus targeting Egln1, Egln2 and EGLN3, respectively, was washed once in ice-cold PBS, trypsinized and subsequently harvested with 10 ml ice-cold PBS, collected by centrifugation (5 min at 1,200g, 4 °C), resuspended and homogenized in EBC buffer (50 mM Tris at pH 8.0, 120 mM NaCl, 0.5% NP-40) containing protease inhibitor and phosphatase inhibitor. The lysates were centrifuged at 14,000g for 10 min to pellet unlysed cellular debris and the resulting supernatant was incubated with HA antibody overnight at 4 °C. Samples were incubated for 5 h with rotation at 4 °C with 70 μl (50% slurry) Protein G agarose beads (sc-2002, Santa Cruz) were pre-washed twice with immunoprecipitation washing buffer (0.5% NP-40, 150 mM NaCl, 10 mM Tris-HCl). Samples were centrifuged at 8,000g for 30 s and washed five times with immunoprecipitation washing buffer (0.5% NP-40, 150 mM NaCl, 10 mM Tris-HCl). Immunoprecipitated proteins were eluted with 50 μl Laemmli buffer, boiled for 5 min and centrifuged at 8,000g for 1 min. The resulting eluted supernatant was subjected to immunoblot analysis.

Co-immunoprecipitation using anti-hydroxyproline antibody

293FT cells were transiently transfected with plasmids encoding Flag-TFAM and Flag-EGLN3 WT or catalytically dead mutant (Mut) with or without DMOG treatment or transiently transfected with plasmids encoding Flag-TFAM and HA-Egln1, HA-Egln2 and HA-EGLN3. Immunoprecipitation using anti-hydroxyproline antibody (HydroxyP; ab37067, GR3215743-1 and GR3179915-1) from 293FT cells (Fig. 4b and Extended Data Fig. 4a) was performed as described above.

Protein kinase A activity assay

Hydroxylated TFAM (1 μg) biotinylated peptide was conjugated with 30 μl Streptavidin agarose beads (GE Healthcare Life Sciences) in 1 ml PBS at room temperature with rotation for 1 h. The beads pellet was washed three times with PBS and resuspended in 500 μl PBS supplemented with 1 μg purified GST-pVHL protein for 2 h at room temperature. Subsequently, TFAM phosphorylation by PKA was assayed using PKA Kinase Activity Assay Kit (ab139435, Abcam) according to the manufacturer’s instructions. Samples were centrifuged at 8,000g for 30 s and washed three times with PBS and resuspended with 50 μl kinase assay dilution buffer supplemented with 1 μg μl⁻¹ ATP and 50 ng purified active PKA. The phosphorylation assay was processed for 40 min at room temperature with rotation and for 40 min at 30 °C. Samples were centrifuged at 8,000g for 30 s and washed three times with PBS and eluted with 30 μl Laemmli buffer, boiled for 5 min and centrifuged at 8,000g for 30 s. Eluted supernatant was analysed by immunoblotting using pan-phospho-serine antibody (Santa Cruz, sc-81514).

Crystal violet staining for apoptosis

ccRCC 786-O cells and MEFs were treated with 3-BP or gossypol for the indicated times. Cells were washed once with PBS and then fixed and stained by crystal violet solution (0.1% crystal violet, 20% methanol, 80% dH₂O) for 45 min at room temperature and washed four times with PBS.

TFAM half-life

786-O cells and MEFs were cultured in six-well plates in 2 ml DMEM medium to reach 50% confluency. Cells were treated with 10 μM cycloheximide at the indicated times, subsequently harvested and lysed in EBC lysis buffer. Cell lysates were then subjected to western blot analysis with the rabbit anti-TFAM antibody.

Evaluation of mitochondrial respiration rate and extracellular acidification rate

The OCR and ECAR were determined using Mito Stress Test Kit (Agilent,103015–100), Glycolysis Stress Test Kit (Agilent, 103020-100) and an XFe96 Extracellular Flux Analyzer (Seahorse Bioscience). Then, the XFe96 Sensor Cartridge (102416-100) was hydrated using 200 μl of sterile calibrant (100840-000) in each well of the utility plate. The assembled sensor cartridge and utility plate were kept in a 37 °C CO₂-free incubator overnight. 786-O cells and MEFs were seeded into XFe96 cell culture microplates (101085-004) at a density of 10,000 cells per well and allowed to adhere to plate overnight. The cell culture medium was replaced with Seahorse XF DMEM medium (103575-100) containing 10 mM glucose, 2 mM glutamine, 1 mM pyruvate and placed in a 37 °C CO₂-free incubator for 1 h. Finally, after preincubation, OCR was measured in the Agilent’s Seahorse Bioscience XF-96 Extracellular Flux Analyzer (Agilent Technologies) from the baseline OCR determination and subsequent sequential injections of three compounds that affect the cellular bioenergetic processes, as follows: 20 μl of oligomycin (10 μM) in port A, 22 μl of FCCP (10 μM) in port B and 25 μl of rotenone/antimycin A (5 μM) in port C, according to the manufacturer’s instructions and protocols. ECAR was measured from the baseline ECAR determination and subsequent sequential injections of three compounds as follows: 20 μl of glucose (100 mM) in port A, 22 μl of oligomycin (10 μM) in port B and 25 μl of 2-deoxy-d-glucose (500 μM) in port C, according to the manufacturer’s instructions and protocols.

Proximity ligation assay, image acquisition and image processing

786-0 cells (pRC3 and VHL WT) were plated on glass coverslips. Cells were incubated with 100 nM MitoTracker Red CMXRos (Invitrogen) for 1 h at 37 °C and fixed with 4% paraformaldehyde and permeabilized using 0.1% Triton X-100 (Sigma-Aldrich) in PBS. After incubation with TFAM and VHL antibodies (1:500 dilution; 8076, Cell Signalling Technology; and 1:1,000 dilution; 564183, Becton Dickinson, respectively) at 4 °C overnight, the PLA assay was performed using Duolink In Situ PLA Probe Anti-Rabbit PLUS and Anti-Mouse MINUS, and Duolink In Situ Detection Reagents Green (Sigma-Aldrich) following the manufacturer’s instructions. The immunofluorescence signals were acquired by an LSM 700 Laser Scanning Confocal System with Zeiss Observer Z1 Inverted Phase Contrast Fluorescence Microscope (ZEISS) using ×63 magnification. Twenty images of randomly selected areas per cell line were taken. Each fluorophore channel was pseudo-coloured in ZEN2 (ZEISS), exported as JPEG, and analysed using the CellProfiler 4.2.0 cell image analysis software (Broad Institute of Harvard and MIT). The number of PLA signals per cell was quantified from the maximal intensity projection of each image. Statistical analysis was performed using Prism 9 software to calculate the non-parametric Mann–Whitney U test (GraphPad). A P value < 0.05 was considered significant.

Mitochondrial fractionation

The mitochondria were isolated as previously described⁵⁵. The cells were collected and resuspended in the MSE buffer (109 mg ml⁻¹ mannitol (M4125, Sigma), 10 mM Tris pH 7.4, 1 mM EDTA) containing 0.1% BSA (A7030, Sigma). The cells were homogenized followed by low-speed centrifugation to remove the cell debris. Mitochondria were pelleted and washed with MSE buffer. One-third of the mitochondrial fraction was pelleted as ‘untreated mitochondrial fraction’. Two-thirds of the mitochondria were digested with 15 µg ml⁻¹ proteinase K (25530049, Thermo Fisher); half of them were treated with 1 mM PMSF followed by washing twice with MSE buffer containing PMSF and the other half was treated with 1% Triton-X-100. The total cell and mitochondrial fractions were lysed in the lysis buffer (LAGIPT1, Sigma) containing protease inhibitor cocktail (Roche) before loading on the SDS–PAGE.

Chemical reagents

Gossypol (G8761-100 mg), H89 dihydrochloride hydrate (B1427), 3-BP and cycloheximide (C4859) were purchased from Sigma-Aldrich. Bortezomib (B-1408) was purchased from LC Laboratories. MitoTracker Red CMXRos (M7512) and MitoTracker Green FM (M7514) were purchased from Thermo Fisher Scientific. Forskolin (3828) was purchased from Cell Signaling Technology.

Quantification and statistical analysis

The hypothesis that the percentage of mitochondrial proteins was significantly lower in both VHL-null and VHL^L188V cells compared to VHL wild-type-expressing cells was tested. We tested the null hypothesis that there is no difference between the proportion of mitochondrial proteins with significantly higher and significantly lower abundances between the study cases and control (for example, wild type), using two-tailed Fisher’s exact tests. The null hypothesis was rejected using a P-value threshold of 0.01. Further, we tested the hypothesis that (1) the proportion of HIF-independent (for example, p.Leu188Val) and not-HIF-independent (for example, VHL-null excluding intersecting VHL^L188V) significantly downregulated mitochondrial proteins, and (2) the proportion of HIF-independent (for example, VHL mutated PPGL intersecting VHL^L188V) and not-HIF-independent (for example, VHL mutated PPGL excluding intersecting VHL^L188V) significantly downregulated mitochondrial proteins, are not different than the same proportions in significantly downregulated non-mitochondrial proteins. These were analysed using two-tailed Fisher’s exact tests and were rejected using a P-value threshold of 0.01. Fisher’s tests were conducted using the Scipy package version 1.0.0, in Python 2.7.

Analysis of the quantitative proteomics data was performed as previously described. Briefly, TMT reporter was used for MS-based peptide quantification. TMT reporter abundance values were normalized to the total abundance of the same TMT channel. Quality check was performed by calculating the variation (CV) between the replicates as well as by building principal-component analysis models to verify the small data spread between the replicates. The median values of the replicates in each condition were used for fold change calculations. The significance of protein abundance difference between two different conditions was calculated by two-tailed unpaired t-test. Mitochondrial proteins were selected according to the cellular component GO term searched by Proteome Discoverer v2.3 in the human Swiss-Prot protein database.

Reporting summary

Further information on research design is available in the Nature Research Reporting Summary linked to this article.

Data availability

Raw and analysed mass spectrometry data are available at https://www.ebi.ac.uk/pride/. Source data are provided with this paper. All other data associated with this study are presented in the paper or the extended data figures.

Change history

08 September 2022
A Correction to this paper has been published: https://doi.org/10.1038/s42255-022-00651-4

References

Maxwell, P. H. et al. The tumour suppressor protein VHL targets hypoxia-inducible factors for oxygen-dependent proteolysis. Nature 399, 271–275 (1999).
Article CAS PubMed Google Scholar
Kaelin, W. G. Jr. The von Hippel–Lindau tumour suppressor protein: O2 sensing and cancer. Nat. Rev. Cancer 8, 865–873 (2008).
Article CAS PubMed Google Scholar
Kaelin, W. G. Jr. & Ratcliffe, P. J. Oxygen sensing by metazoans: the central role of the HIF hydroxylase pathway. Mol. Cell 30, 393–402 (2008).
Article CAS PubMed Google Scholar
Zhang, H. et al. HIF-1 inhibits mitochondrial biogenesis and cellular respiration in VHL-deficient renal cell carcinoma by repression of C-MYC activity. Cancer Cell 11, 407–420 (2007).
Article CAS PubMed Google Scholar
Kaelin, W. G. Jr. The von Hippel–Lindau tumour suppressor protein: O2 sensing and cancer. Nat. Rev. 8, 865–873 (2008).
Article CAS Google Scholar
Zhuang, Z. et al. Somatic HIF2A gain-of-function mutations in paraganglioma with polycythemia. N. Engl. J. Med. 367, 922–930 (2012).
Article CAS PubMed PubMed Central Google Scholar
Taieb, D. et al. Somatic gain-of-function HIF2A mutations in sporadic central nervous system hemangioblastomas. J. Neurooncol. 126, 473–481 (2016).
Article CAS PubMed Google Scholar
Toledo, R. A. et al. In vivo and in vitro oncogenic effects of HIF2A mutations in pheochromocytomas and paragangliomas. Endocr. Relat. Cancer 20, 349–359 (2013).
Article CAS PubMed PubMed Central Google Scholar
Hoffman, M. A. et al. von Hippel–Lindau protein mutants linked to type 2C VHL disease preserve the ability to downregulate HIF. Hum. Mol. Genet. 10, 1019–1027 (2001).
Article CAS PubMed Google Scholar
Clifford, S. C. et al. Contrasting effects on HIF-1alpha regulation by disease-causing pVHL mutations correlate with patterns of tumorigenesis in von Hippel–Lindau disease. Hum. Mol. Genet. 10, 1029–1038 (2001).
Article CAS PubMed Google Scholar
Kaelin, W. G. Jr. The VHL tumor suppressor gene: insights into oxygen sensing and cancer. Trans. Am. Clin. Climatol. Assoc. 128, 298–307 (2017).
PubMed PubMed Central Google Scholar
Kurban, G. et al. Collagen matrix assembly is driven by the interaction of von Hippel–Lindau tumor suppressor protein with hydroxylated collagen IV alpha 2. Oncogene 27, 1004–1012 (2008).
Article CAS PubMed Google Scholar
Grosfeld, A. et al. Interaction of hydroxylated collagen IV with the von Hippel–Lindau tumor suppressor. J. Biol. Chem. 282, 13264–13269 (2007).
Article CAS PubMed Google Scholar
Ohh, M. et al. The von Hippel–Lindau tumor suppressor protein is required for proper assembly of an extracellular fibronectin matrix. Mol. Cell 1, 959–968 (1998).
Article CAS PubMed Google Scholar
Okuda, H. et al. Direct interaction of the β-domain of VHL tumor suppressor protein with the regulatory domain of atypical PKC isotypes. Biochem. Biophys. Res. Commun. 263, 491–497 (1999).
Article CAS PubMed Google Scholar
Guo, J. et al. pVHL suppresses kinase activity of Akt in a proline-hydroxylation-dependent manner. Science 353, 929–932 (2016).
Article CAS PubMed PubMed Central Google Scholar
Liu, X. et al. Genome-wide screening identifies SFMBT1 as an oncogenic driver in cancer with VHL loss. Mol. Cell 77, 1294–1306 (2020).
Article CAS PubMed PubMed Central Google Scholar
Hu, L. et al. TBK1 is a synthetic lethal target in cancer with VHL loss. Cancer Discov. 10, 460–475 (2020).
Article CAS PubMed Google Scholar
Zhang, J. et al. VHL substrate transcription factor ZHX2 as an oncogenic driver in clear cell renal cell carcinoma. Science 361, 290–295 (2018).
Article PubMed PubMed Central Google Scholar
Li, S. et al. EglN3 hydroxylase stabilizes BIM-EL linking VHL type 2C mutations to pheochromocytoma pathogenesis and chemotherapy resistance. Proc. Natl Acad. Sci. USA 116, 16997–17006 (2019).
Article CAS PubMed PubMed Central Google Scholar
Ang, S. O. et al. Disruption of oxygen homeostasis underlies congenital Chuvash polycythemia. Nat. Genet. 32, 614–621 (2002).
Article CAS PubMed Google Scholar
Gordeuk, V. R. et al. Congenital disorder of oxygen sensing: association of the homozygous Chuvash polycythemia VHL mutation with thrombosis and vascular abnormalities but not tumors. Blood 103, 3924–3932 (2004).
Article CAS PubMed Google Scholar
Hickey, M. M., Lam, J. C., Bezman, N. A., Rathmell, W. K. & Simon, M. C. von Hippel–Lindau mutation in mice recapitulates Chuvash polycythemia via hypoxia-inducible factor-2α signaling and splenic erythropoiesis. J. Clin. Invest. 117, 3879–3889 (2007).
CAS PubMed PubMed Central Google Scholar
Bond, J. et al. Dysregulation of the HIF pathway due to VHL mutation causing severe erythrocytosis and pulmonary arterial hypertension. Blood 117, 3699–3701 (2011).
Article CAS PubMed Google Scholar
Liang, H. & Ward, W. F. PGC-1alpha: a key regulator of energy metabolism. Adv. Physiol. Educ. 30, 145–151 (2006).
Article PubMed Google Scholar
Nilsson, H. et al. Primary clear cell renal carcinoma cells display minimal mitochondrial respiratory capacity resulting in pronounced sensitivity to glycolytic inhibition by 3-bromopyruvate. Cell Death Dis. 6, e1585 (2015).
Article CAS PubMed PubMed Central Google Scholar
Xie, L. et al. Oxygen-regulated beta(2)-adrenergic receptor hydroxylation by EGLN3 and ubiquitylation by pVHL. Sci. Signal. 2, ra33 (2009).
Article PubMed PubMed Central Google Scholar
Handschin, C. & Spiegelman, B. M. The role of exercise and PGC1α in inflammation and chronic disease. Nature 454, 463–469 (2008).
Article CAS PubMed PubMed Central Google Scholar
Hillen, H. S., Morozov, Y. I., Sarfallah, A., Temiakov, D. & Cramer, P. Structural basis of mitochondrial transcription initiation. Cell 171, 1072–1081(2017).
Article CAS PubMed PubMed Central Google Scholar
Shiao, Y. H., Resau, J. H., Nagashima, K., Anderson, L. M. & Ramakrishna, G. The von Hippel–Lindau tumor suppressor targets to mitochondria. Cancer Res. 60, 2816–2819 (2000).
CAS PubMed Google Scholar
Lu, B. et al. Phosphorylation of human TFAM in mitochondria impairs DNA binding and promotes degradation by the AAA+ Lon protease. Mol. Cell 49, 121–132 (2013).
Article CAS PubMed Google Scholar
Matsushima, Y., Goto, Y. & Kaguni, L. S. Mitochondrial Lon protease regulates mitochondrial DNA copy number and transcription by selective degradation of mitochondrial transcription factor A (TFAM). Proc. Natl Acad. Sci. USA 107, 18410–18415 (2010).
Article CAS PubMed PubMed Central Google Scholar
Couve, S. et al. Genetic evidence of a precisely tuned dysregulation in the hypoxia signaling pathway during oncogenesis. Cancer Res. 74, 6554–6564 (2014).
Article CAS PubMed PubMed Central Google Scholar
Agathocleous, M. et al. Metabolic differentiation in the embryonic retina. Nat. Cell Biol. 14, 859–864 (2012).
Article CAS PubMed PubMed Central Google Scholar
Zheng, X. et al. Metabolic reprogramming during neuronal differentiation from aerobic glycolysis to neuronal oxidative phosphorylation. Elife https://doi.org/10.7554/eLife.13374 (2016).
Greene, L. A. & Tischler, A. S. Establishment of a noradrenergic clonal line of rat adrenal pheochromocytoma cells which respond to nerve growth factor. Proc. Natl Acad. Sci. USA 73, 2424–2428 (1976).
Article CAS PubMed PubMed Central Google Scholar
Greene, L. A. Nerve growth factor prevents the death and stimulates the neuronal differentiation of clonal PC12 pheochromocytoma cells in serum-free medium. J. Cell Biol. 78, 747–755 (1978).
Article CAS PubMed PubMed Central Google Scholar
Barletta, J. A. & Hornick, J. L. Succinate dehydrogenase-deficient tumors: diagnostic advances and clinical implications. Adv. Anat. Pathol. 19, 193–203 (2012).
Article CAS PubMed Google Scholar
Toro, J. R. et al. Mutations in the fumarate hydratase gene cause hereditary leiomyomatosis and renal cell cancer in families in North America. Am. J. Hum. Genet. 73, 95–106 (2003).
Article CAS PubMed PubMed Central Google Scholar
Ward, P. S. et al. The common feature of leukemia-associated IDH1 and IDH2 mutations is a neomorphic enzyme activity converting alpha-ketoglutarate to 2-hydroxyglutarate. Cancer Cell 17, 225–234 (2010).
Article CAS PubMed PubMed Central Google Scholar
Wang, Y. et al. WT1 recruits TET2 to regulate its target gene expression and suppress leukemia cell proliferation. Mol. Cell 57, 662–673 (2015).
Article PubMed PubMed Central Google Scholar
Kaelin, W. G. Von Hippel–Lindau disease. Annu Rev. Pathol. 2, 145–173 (2007).
Article CAS PubMed Google Scholar
Brauch, H. et al. Sporadic pheochromocytomas are rarely associated with germline mutations in the vhl tumor suppressor gene or the ret protooncogene. J. Clin. Endocrinol. Metab. 82, 4101–4104 (1997).
CAS PubMed Google Scholar
Percy, M. J. et al. A gain-of-function mutation in the HIF2A gene in familial erythrocytosis. N. Engl. J. Med. 358, 162–168 (2008).
Article CAS PubMed PubMed Central Google Scholar
Chen, W. et al. Targeting renal cell carcinoma with a HIF-2 antagonist. Nature 539, 112–117 (2016).
Article CAS PubMed PubMed Central Google Scholar
Vander Heiden, M. G. & DeBerardinis, R. J. Understanding the intersections between metabolism and cancer biology. Cell 168, 657–669 (2017).
Article PubMed Central Google Scholar
Siegel, R. L., Miller, K. D. & Jemal, A. Cancer Statistics, 2017. CA Cancer J. Clin. 67, 7–30 (2017).
Article PubMed Google Scholar
Schlisio, S. et al. The kinesin KIF1Bβ acts downstream from EglN3 to induce apoptosis and is a potential 1p36 tumor suppressor. Genes Dev. 22, 884–893 (2008).
Article CAS PubMed PubMed Central Google Scholar
Young, A. P. et al. VHL loss actuates a HIF-independent senescence programme mediated by Rb and p400. Nat. Cell Biol. 10, 361–369 (2008).
Article CAS PubMed Google Scholar
Fell, S. M. et al. Neuroblast differentiation during development and in neuroblastoma requires KIF1Bβ-mediated transport of TRKA. Genes Dev. 31, 1036–1053 (2017).
Article CAS PubMed PubMed Central Google Scholar
Welander, J. et al. Rare germline mutations identified by targeted next-generation sequencing of susceptibility genes in pheochromocytoma and paraganglioma. J. Clin. Endocrinol. Metab. https://doi.org/10.1210/jc.2013-4375 (2014).
Li, S. et al. The 1p36 tumor suppressor KIF1Bβ is required for calcineurin activation, controlling mitochondrial fission and apoptosis. Dev. Cell 36, 164–178 (2016).
Article CAS PubMed Google Scholar
Rodriguez, J. et al. Substrate-trapped interactors of PHD3 and FIH cluster in distinct signaling pathways. Cell Rep. 14, 2745–2760 (2016).
Article CAS PubMed PubMed Central Google Scholar
Lee, S. et al. Neuronal apoptosis linked to EglN3 prolyl hydroxylase and familial pheochromocytoma genes: developmental culling and cancer. Cancer Cell 8, 155–167 (2005).
Article PubMed Google Scholar
Minczuk, M. et al. TEFM (c17orf42) is necessary for transcription of human mtDNA. Nucleic Acids Res. 39, 4284–4299 (2011).
Article CAS PubMed PubMed Central Google Scholar

Download references

Acknowledgements

W.L. was funded by the China Scholarship Council. S.L. and M.P. were funded by the Swedish Childhood Cancer Fund. J.H. was funded by the Swedish Cancer Society, The Swedish Brain Foundation, Knut and Alice Wallenberg Foundation and L. Sagens and C. Erikssons Foundation. J.R. received funding from the Swedish Research Council. A.v.K. was funded by a Multiuser Equipment Grant (208402/Z/17/Z) from the Wellcome trust. S.S. was funded by the Swedish Research Council, the Swedish Childhood Cancer Fund, the Swedish Cancer Society, Knut and Alice Wallenberg Foundation and ParaDiff foundation and supported by an ERC Synergy grant (KILL-OR-DIFFERENTIAT). The virus was made by the VirusTech Core Facility of Karolinska Institutet.

Funding

Open access funding provided by Karolinska Institute.

Author information

These authors contributed equally: Wenyu Li, Juan Yuan.

Authors and Affiliations

Department of Microbiology, Tumor and Cell Biology, Karolinska Institutet, Stockholm, Sweden
Shuijie Li, Wenyu Li, Juan Yuan, Petra Bullova, Jieyu Wu, Monika Plescher, Oscar C. Bedoya-Reina, Marie Arsenian Henriksson, Yihai Cao & Susanne Schlisio
College of Pharmacy, Harbin Medical University, Harbin, China
Shuijie Li
Department of Medical Biochemistry and Biophysics, Karolinska Institute, Stockholm, Sweden
Xuepei Zhang, Yong Liu & Roman A. Zubarev
Edinburgh Cancer Research Centre, IGMM, University of Edinburgh, Edinburgh, UK
Javier Rodriguez & Alex von Kriegsheim
Department of Physiology and Pharmacology, Karolinska Institutet, Stockholm, Sweden
Paulo R. Jannig, Paula Valente-Silva & Jorge L. Ruas
Department of Medicine, Karolinska University Hospital, Stockholm, Sweden
Meng Yu & Anna Smed-Sörensen
Department of Microbiology, Biochemistry and Molecular Genetics, Rutgers University-New Jersey Medical School, Newark, NJ, USA
Carolyn K. Suzuki
Department of Molecular Biology, Faculty of Medicine, Umeå University, Umeå, Sweden
Johan Holmberg
Department of Oncology-Pathology, Karolinska Institutet, Karolinska University Hospital, Stockholm, Sweden
Catharina Larsson & C. Christofer Juhlin

Authors

Shuijie Li
View author publications
You can also search for this author in PubMed Google Scholar
Wenyu Li
View author publications
You can also search for this author in PubMed Google Scholar
Juan Yuan
View author publications
You can also search for this author in PubMed Google Scholar
Petra Bullova
View author publications
You can also search for this author in PubMed Google Scholar
Jieyu Wu
View author publications
You can also search for this author in PubMed Google Scholar
Xuepei Zhang
View author publications
You can also search for this author in PubMed Google Scholar
Yong Liu
View author publications
You can also search for this author in PubMed Google Scholar
Monika Plescher
View author publications
You can also search for this author in PubMed Google Scholar
Javier Rodriguez
View author publications
You can also search for this author in PubMed Google Scholar
Oscar C. Bedoya-Reina
View author publications
You can also search for this author in PubMed Google Scholar
Paulo R. Jannig
View author publications
You can also search for this author in PubMed Google Scholar
Paula Valente-Silva
View author publications
You can also search for this author in PubMed Google Scholar
Meng Yu
View author publications
You can also search for this author in PubMed Google Scholar
Marie Arsenian Henriksson
View author publications
You can also search for this author in PubMed Google Scholar
Roman A. Zubarev
View author publications
You can also search for this author in PubMed Google Scholar
Anna Smed-Sörensen
View author publications
You can also search for this author in PubMed Google Scholar
Carolyn K. Suzuki
View author publications
You can also search for this author in PubMed Google Scholar
Jorge L. Ruas
View author publications
You can also search for this author in PubMed Google Scholar
Johan Holmberg
View author publications
You can also search for this author in PubMed Google Scholar
Catharina Larsson
View author publications
You can also search for this author in PubMed Google Scholar
C. Christofer Juhlin
View author publications
You can also search for this author in PubMed Google Scholar
Alex von Kriegsheim
View author publications
You can also search for this author in PubMed Google Scholar
Yihai Cao
View author publications
You can also search for this author in PubMed Google Scholar
Susanne Schlisio
View author publications
You can also search for this author in PubMed Google Scholar

Contributions

Conceptualization, S.L. and S.S.; methodology, S.L., W.L., J.Y., P.B., J.W., M.P., Y.L., J.R., M.Y., P.R.J., P.V.-S., J.L.R., Y.C., M.A.H. and A.v.K.; investigation, S.L., W.L., P.B., M.P., J.H., J.R., A.v.K. and S.S.; computational investigation and analysis, O.C.B.-R. and X.Z.; PPGL sample collection and characterization, C.C.J. and C.L.; writing, S.L. and S.S.; funding acquisition, resources and supervision, S.S.

Corresponding authors

Correspondence to Shuijie Li or Susanne Schlisio.

Ethics declarations

Competing interests

All authors declare no competing interests.

Peer review

Peer review information

Source data

Supplementary information

Supplementary Information

Supplementary Figs. 1 and 2, including legends (FACS gating strategies and western blot quantification).

Reporting Summary

Supplementary Table 1

The cellular proteomes from primary PPGL tumours were extracted and analysed by nanoLC–MS/MS; 6,196 proteins were identified and quantified, 5,576 of which were common to all the samples.

Supplementary Table 2

List of mitochondrial proteins. Analysing the proteome of VHL-null and VHL^L188V cells confirmed that the percentage of mitochondrial proteins was significantly lower in both VHL-null cells as compared to VHL wild-type expressing cells.

Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.

Reprints and permissions

About this article

Cite this article

Li, S., Li, W., Yuan, J. et al. Impaired oxygen-sensitive regulation of mitochondrial biogenesis within the von Hippel–Lindau syndrome. Nat Metab 4, 739–758 (2022). https://doi.org/10.1038/s42255-022-00593-x

Download citation

Received: 25 January 2021
Accepted: 20 May 2022
Published: 27 June 2022
Issue Date: June 2022
DOI: https://doi.org/10.1038/s42255-022-00593-x

This article is cited by

Poly-3-hydroxybutyrate-co-3-hydroxyvalerate(PHBV)-Polyethylene glycol 20k(PEG20k) as a promising delivery system for PT2399 in the treatment of disc degeneration
- Zhencong Li
- Weilin Zhang
- Jinsong Wei
Journal of Biological Engineering (2024)
A novel mitochondrial unfolded protein response-related risk signature to predict prognosis, immunotherapy and sorafenib sensitivity in hepatocellular carcinoma
- Sidi Zhang
- Hanyao Guo
- Ke Tan
Apoptosis (2024)